GUSB (Myc-DDK-tagged)-Human glucuronidase, beta (GUSB)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GUSB (Myc-DDK-tagged)-Human glucuronidase, beta (GUSB)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human glucuronidase, beta (GUSB)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, GUSB (Myc-DDK tagged) - Human glucuronidase, beta (GUSB), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, GUSB (mGFP-tagged) - Human glucuronidase, beta (GUSB), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GUSB (GFP-tagged) - Human glucuronidase, beta (GUSB)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
5 Weeks
Lenti ORF particles, GUSB (Myc-DDK tagged) - Human glucuronidase, beta (GUSB), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, GUSB (mGFP-tagged) - Human glucuronidase, beta (GUSB), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GUSB (myc-DDK-tagged) - Human glucuronidase, beta (GUSB), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GUSB (myc-DDK-tagged) - Human glucuronidase, beta (GUSB), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GUSB (myc-DDK-tagged) - Human glucuronidase, beta (GUSB), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GUSB (untagged)-Human glucuronidase, beta (GUSB)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of glucuronidase, beta (GUSB)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human glucuronidase, beta (GUSB), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
beta glucuronidase (GUSB) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Porcine |
Immunogen | KLH conjugated synthetic peptide between 335 - 362 amino acids from the Center region of Human Beta-glucuronidase |
Rabbit polyclonal anti-GUSB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GUSB. |
Lenti ORF clone of Human glucuronidase, beta (GUSB), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
beta glucuronidase (GUSB) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 514-544 amino acids from the C-terminal region of Human Beta-glucuronidase |
GUSB HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-GUSB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF |
GUSB MS Standard C13 and N15-labeled recombinant protein (NP_000172)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
GUSB (GFP-tagged) - Human glucuronidase, beta (GUSB), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GUSB (GFP-tagged) - Human glucuronidase, beta (GUSB), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GUSB (GFP-tagged) - Human glucuronidase, beta (GUSB), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GUSB (untagged) - Human glucuronidase, beta (GUSB), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GUSB (untagged) - Human glucuronidase, beta (GUSB), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GUSB (untagged) - Human glucuronidase, beta (GUSB), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of GUSB (NM_000181) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GUSB (NM_001293105) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GUSB (NM_001293104) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GUSB (NM_001284290) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GUSB (NM_000181) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GUSB (NM_000181) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GUSB (NM_001293105) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GUSB (NM_001293104) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GUSB (NM_001284290) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack