Products

cDNA Clones (25)
Proteins (13)
Antibodies (3)
Jump to Filters
View as table Download
KCNC4 (NM_004978) Human Tagged ORF Clone
RC212078

USD 98.00

USD 780.00

In Stock

KCNC4 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
KCNC4 (NM_153763) Human Tagged ORF Clone
RG211017

USD 770.00

In Stock

KCNC4 (GFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNC4 (NM_004978) Human Tagged ORF Clone Lentiviral Particle
RC212078L1V

USD 820.00

6 Weeks

Lenti ORF particles, KCNC4 (Myc-DDK tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
KCNC4 (NM_004978) Human Tagged ORF Clone Lentiviral Particle
RC212078L2V

USD 820.00

6 Weeks

Lenti ORF particles, KCNC4 (mGFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
KCNC4 (NM_001039574) Human Tagged ORF Clone
RC217719

USD 98.00

USD 770.00

In Stock

KCNC4 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNC4 (NM_153763) Human Tagged ORF Clone
RC211017

USD 698.00

In Stock

KCNC4 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNC4 (NM_004978) Human Tagged ORF Clone
RG212078

USD 460.00

In Stock

KCNC4 (GFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNC4 (NM_153763) Human Tagged ORF Clone
RC211017L3

USD 898.00

3 Weeks

Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNC4 (NM_153763) Human Tagged ORF Clone Lentiviral Particle
RC211017L3V

USD 1,098.00

6 Weeks

Lenti ORF particles, KCNC4 (Myc-DDK tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNC4 (NM_153763) Human Tagged ORF Clone
RC211017L4

USD 898.00

3 Weeks

Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNC4 (NM_153763) Human Tagged ORF Clone Lentiviral Particle
RC211017L4V

USD 1,098.00

6 Weeks

Lenti ORF particles, KCNC4 (mGFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNC4 (NM_004978) Human Tagged ORF Clone
RC212078L3

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNC4 (NM_004978) Human Tagged ORF Clone Lentiviral Particle
RC212078L3V

USD 820.00

6 Weeks

Lenti ORF particles, KCNC4 (Myc-DDK tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNC4 (NM_004978) Human Tagged ORF Clone
RC212078L4

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNC4 (NM_004978) Human Tagged ORF Clone Lentiviral Particle
RC212078L4V

USD 820.00

6 Weeks

Lenti ORF particles, KCNC4 (mGFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNC4 (NM_001039574) Human Tagged ORF Clone
RC217719L3

USD 620.00

3 Weeks

Lenti-ORF clone of KCNC4 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNC4 (NM_001039574) Human Tagged ORF Clone Lentiviral Particle
RC217719L3V

USD 820.00

6 Weeks

Lenti ORF particles, KCNC4 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNC4 (NM_001039574) Human Tagged ORF Clone
RC217719L4

USD 620.00

3 Weeks

Lenti-ORF clone of KCNC4 (mGFP-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNC4 (NM_001039574) Human Tagged ORF Clone Lentiviral Particle
RC217719L4V

USD 820.00

6 Weeks

Lenti ORF particles, KCNC4 (mGFP-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNC4 (NM_001039574) Human Tagged ORF Clone
RG217719

USD 460.00

3 Weeks

KCNC4 (GFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNC4 Rabbit Polyclonal Antibody
AP21098PU-N

USD 407.00

2 Weeks

KCNC4 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
KCNC4 (NM_004978) Human Tagged ORF Clone
RC212078L1

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
KCNC4 (NM_004978) Human Tagged ORF Clone
RC212078L2

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
KCNC4 (NM_004978) Human Over-expression Lysate
LC401547

USD 187.00

In Stock

KCNC4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
KCNC4 (NM_001039574) Human Over-expression Lysate
LC422076

USD 187.00

In Stock

KCNC4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNC4 (NM_001039574) Human Over-expression Lysate
LY422076

USD 605.00

In Stock

Transient overexpression lysate of potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNC4 (NM_004978) Human Untagged Clone
SC111648

USD 1,070.00

In Stock

KCNC4 (untagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
KCNC4 Rabbit Polyclonal Antibody
TA338546

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNC4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNC4 antibody: synthetic peptide directed towards the middle region of human KCNC4. Synthetic peptide located within the following region: NIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRIV
KCNC4 (C-term) Rabbit Polyclonal Antibody
AP52301PU-N

USD 450.00

2 Weeks

KCNC4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 517-546 amino acids from the C-terminal region of human KCNC4
KCNC4 (NM_004978) Human Over-expression Lysate
LY401547

USD 605.00

5 Days

Transient overexpression lysate of potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNC4 (NM_153763) Human Untagged Clone
SC309151

USD 760.00

3 Weeks

KCNC4 (untagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
KCNC4 (NM_001039574) Human Untagged Clone
SC310765

USD 1,060.00

3 Weeks

KCNC4 (untagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
KCNC4 ICC Control Block
TB411017

USD 1,348.00

4 Weeks

Transient overexpression of KCNC4 (NM_153763) in HEK293T cells paraffin embedded controls for ICC/IHC staining

KCNC4 ICC Control Block
TB412078

USD 1,430.00

4 Weeks

Transient overexpression of KCNC4 (NM_004978) in HEK293T cells paraffin embedded controls for ICC/IHC staining

KCNC4 ICC Control Block
TB417719

USD 1,420.00

4 Weeks

Transient overexpression of KCNC4 (NM_001039574) in HEK293T cells paraffin embedded controls for ICC/IHC staining

KCNC4 Cytosection
TS411017

USD 225.00

4 Weeks

Transient overexpression of KCNC4 (NM_153763) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

KCNC4 ICC Control Sections
TS411017P5

USD 889.00

4 Weeks

Transient overexpression of KCNC4 (NM_153763) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

KCNC4 Cytosection
TS412078

USD 225.00

4 Weeks

Transient overexpression of KCNC4 (NM_004978) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

KCNC4 Cytosection
TS412078P5

USD 889.00

4 Weeks

Transient overexpression of KCNC4 (NM_004978) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

KCNC4 Cytosection
TS417719

USD 225.00

4 Weeks

Transient overexpression of KCNC4 (NM_001039574) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

KCNC4 Cytosection
TS417719P5

USD 889.00

4 Weeks

Transient overexpression of KCNC4 (NM_001039574) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack