Germany
Japan
United Kingdom
China
MARCH5 (Myc-DDK-tagged)-Human membrane-associated ring finger (C3HC4) 5 (MARCH5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
41338 (GFP-tagged) - Human membrane-associated ring finger (C3HC4) 5 (MARCH5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human membrane-associated ring finger (C3HC4) 5 (MARCH5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MARCH5 (Myc-DDK tagged) - Human membrane-associated ring finger 5 (MARCH5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human membrane-associated ring finger (C3HC4) 5 (MARCH5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MARCH5 (mGFP-tagged) - Human membrane-associated ring finger (C3HC4) 5 (MARCH5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
41338 (untagged)-Human membrane-associated ring finger (C3HC4) 5 (MARCH5)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-MARCH5 antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MARCH5. |
Rabbit Polyclonal Anti-MARCH5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MARCH5 antibody: synthetic peptide directed towards the N terminal of human MARCH5. Synthetic peptide located within the following region: CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY |
Rabbit Polyclonal Anti-MARCH5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MARCH5 antibody: synthetic peptide directed towards the C terminal of human MARCH5. Synthetic peptide located within the following region: VNSNLQRTILGGIAFVAIKGAFKVYFKQQQYLRQAHRKILNYPEQEEA |
42068 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of membrane-associated ring finger (C3HC4) 5 (MARCH5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression of 43895 (NM_017824) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of 43895 (NM_017824) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of 43895 (NM_017824) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MARCH5
Families
- Transmembrane