MARCH5 (Myc-DDK-tagged)-Human membrane-associated ring finger (C3HC4) 5 (MARCH5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MARCH5 (Myc-DDK-tagged)-Human membrane-associated ring finger (C3HC4) 5 (MARCH5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
41338 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, March5 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, March5 (GFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
41338 (Myc-DDK-tagged ORF) - Rat membrane-associated ring finger (C3HC4) 5 (March5), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
41338 (GFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
41338 (GFP-tagged) - Human membrane-associated ring finger (C3HC4) 5 (MARCH5)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MARCH5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
March5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
41338 (GFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5) transcript variant 2, (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
41338 (GFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5) transcript variant 3, (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of 41338 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, March5 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of 41338 (mGFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, March5 (GFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
41338 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of 41338 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, March5 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of 41338 (mGFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, March5 (GFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
41338 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of 41338 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, March5 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of 41338 (mGFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, March5 (GFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human membrane-associated ring finger (C3HC4) 5 (MARCH5), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MARCH5 (Myc-DDK tagged) - Human membrane-associated ring finger 5 (MARCH5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human membrane-associated ring finger (C3HC4) 5 (MARCH5), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MARCH5 (mGFP-tagged) - Human membrane-associated ring finger (C3HC4) 5 (MARCH5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of 41338 (Myc-DDK-tagged ORF) - Rat membrane-associated ring finger (C3HC4) 5 (March5), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, March5 (Myc-DDK-tagged ORF) - Rat membrane-associated ring finger (C3HC4) 5 (March5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of 41338 (mGFP-tagged ORF) - Rat membrane-associated ring finger (C3HC4) 5 (March5), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, March5 (GFP-tagged ORF) - Rat membrane-associated ring finger (C3HC4) 5 (March5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of 41338 (mGFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
41338 (untagged)-Human membrane-associated ring finger (C3HC4) 5 (MARCH5)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
MARCH5 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
Format | Retroviral plasmids |
Vector | pGFP-V-RS |
March5 - Rat, 4 unique 29mer shRNA constructs in retroviral GFP vector
Format | Retroviral plasmids |
Vector | pGFP-V-RS |
41338 (untagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1, (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of 41338 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
March5 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
Format | Retroviral plasmids |
Vector | pGFP-V-RS |
March5 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Rabbit polyclonal anti-MARCH5 antibody
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MARCH5. |
Rabbit Polyclonal Anti-MARCH5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MARCH5 antibody: synthetic peptide directed towards the N terminal of human MARCH5. Synthetic peptide located within the following region: CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY |
Rabbit Polyclonal Anti-MARCH5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MARCH5 antibody: synthetic peptide directed towards the C terminal of human MARCH5. Synthetic peptide located within the following region: VNSNLQRTILGGIAFVAIKGAFKVYFKQQQYLRQAHRKILNYPEQEEA |
MARCH5 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
March5 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
MARCH5 CRISPRa kit - CRISPR gene activation of human membrane associated ring-CH-type finger 5
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
March5 CRISPRa kit - CRISPR gene activation of mouse membrane-associated ring finger (C3HC4) 5
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene MARCH5
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene MARCH5