Products

View as table Download

MARCH5 (Myc-DDK-tagged)-Human membrane-associated ring finger (C3HC4) 5 (MARCH5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

41338 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, March5 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, March5 (GFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

41338 (Myc-DDK-tagged ORF) - Rat membrane-associated ring finger (C3HC4) 5 (March5), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

41338 (GFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

41338 (GFP-tagged) - Human membrane-associated ring finger (C3HC4) 5 (MARCH5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MARCH5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN415645 is the updated version of KN215645.

March5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN509788 is the updated version of KN309788.

41338 (GFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

41338 (GFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5) transcript variant 3, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of 41338 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, March5 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of 41338 (mGFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, March5 (GFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

41338 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of 41338 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, March5 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of 41338 (mGFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, March5 (GFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

41338 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of 41338 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, March5 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of 41338 (mGFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, March5 (GFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human membrane-associated ring finger (C3HC4) 5 (MARCH5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MARCH5 (Myc-DDK tagged) - Human membrane-associated ring finger 5 (MARCH5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human membrane-associated ring finger (C3HC4) 5 (MARCH5), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MARCH5 (mGFP-tagged) - Human membrane-associated ring finger (C3HC4) 5 (MARCH5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of 41338 (Myc-DDK-tagged ORF) - Rat membrane-associated ring finger (C3HC4) 5 (March5), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, March5 (Myc-DDK-tagged ORF) - Rat membrane-associated ring finger (C3HC4) 5 (March5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of 41338 (mGFP-tagged ORF) - Rat membrane-associated ring finger (C3HC4) 5 (March5), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, March5 (GFP-tagged ORF) - Rat membrane-associated ring finger (C3HC4) 5 (March5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of 41338 (mGFP-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

41338 (untagged)-Human membrane-associated ring finger (C3HC4) 5 (MARCH5)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

MARCH5 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS

March5 - Rat, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS

41338 (untagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

Lenti ORF clone of 41338 (Myc-DDK-tagged) - Mouse membrane-associated ring finger (C3HC4) 5 (March5), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

March5 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS

March5 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

Rabbit polyclonal anti-MARCH5 antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MARCH5.

Rabbit Polyclonal Anti-MARCH5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MARCH5 antibody: synthetic peptide directed towards the N terminal of human MARCH5. Synthetic peptide located within the following region: CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY

Rabbit Polyclonal Anti-MARCH5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MARCH5 antibody: synthetic peptide directed towards the C terminal of human MARCH5. Synthetic peptide located within the following region: VNSNLQRTILGGIAFVAIKGAFKVYFKQQQYLRQAHRKILNYPEQEEA

MARCH5 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

March5 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

MARCH5 CRISPRa kit - CRISPR gene activation of human membrane associated ring-CH-type finger 5

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

March5 CRISPRa kit - CRISPR gene activation of mouse membrane-associated ring finger (C3HC4) 5

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene MARCH5

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene MARCH5