NOX1 (Myc-DDK-tagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
NOX1 (Myc-DDK-tagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, NOX1 (Myc-DDK tagged) - Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, NOX1 (mGFP-tagged) - Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
NOX1 (GFP-tagged) - Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NOX1 (Myc-DDK-tagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1Lv
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NOX1 (Myc-DDK tagged) - Homo sapiens NADPH oxidase 1 (NOX1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NOX1 (GFP-tagged) - Human NADPH oxidase 1 (NOX1), transcript variant NOH-1Lv
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NOX1 (Myc-DDK tagged) - Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NOX1 (mGFP-tagged) - Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of NOX1 (Myc-DDK-tagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1Lv
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NOX1 (Myc-DDK-tagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1Lv, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of NOX1 (mGFP-tagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1Lv
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NOX1 (mGFP-tagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1Lv, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
NOX1 (GFP-tagged) - Homo sapiens NADPH oxidase 1 (NOX1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NOX1 (untagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ANGPTL3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ANGPTL3 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human ANGPTL3. |
Lenti ORF clone of Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Goat Anti-NOX1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DKATDIVTGLKQK, from the internal region of the protein sequence according to NP_008983.2; NP_39249.1. |
Rabbit polyclonal anti-NOX1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOX1. |
NOX1 (untagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1Lv
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-NOX1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NOX1 antibody: synthetic peptide directed towards the C terminal of human NOX1. Synthetic peptide located within the following region: STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF |
NOX1 (untagged) - Homo sapiens NADPH oxidase 1 (NOX1), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
Rabbit Polyclonal Anti-NOX1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NOX1 |
Transient overexpression of NOX1 (NM_013955) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NOX1 (NM_007052) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NOX1 (NM_013955) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NOX1 (NM_013955) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NOX1 (NM_001271815) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack