Products

View as table Download

Lenti ORF particles, POR (Myc-DDK tagged) - Human P450 (cytochrome) oxidoreductase (POR), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

POR HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of P450 (cytochrome) oxidoreductase (POR)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-POR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POR antibody: synthetic peptide directed towards the N terminal of human POR. Synthetic peptide located within the following region: IDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT

Rabbit Polyclonal Anti-POR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POR antibody: synthetic peptide directed towards the middle region of human POR. Synthetic peptide located within the following region: VVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTE

Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI5H5 (formerly 5H5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI6C4 (formerly 6C4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI5B3 (formerly 5B3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI5B6 (formerly 5B6)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI3F10 (formerly 3F10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI3H10 (formerly 3H10), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI3H10 (formerly 3H10), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI5H5 (formerly 5H5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI5H5 (formerly 5H5), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI5H5 (formerly 5H5), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI5H5 (formerly 5H5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI6C4 (formerly 6C4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI6C4 (formerly 6C4), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI6C4 (formerly 6C4), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI6C4 (formerly 6C4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI1B11 (formerly 1B11), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI1B11 (formerly 1B11), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP