POR (untagged)-Human P450 (cytochrome) oxidoreductase (POR)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
POR (untagged)-Human P450 (cytochrome) oxidoreductase (POR)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
POR (Myc-DDK-tagged)-Human P450 (cytochrome) oxidoreductase (POR)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human P450 (cytochrome) oxidoreductase (POR)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, POR (Myc-DDK tagged) - Human P450 (cytochrome) oxidoreductase (POR), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, POR (mGFP-tagged) - Human P450 (cytochrome) oxidoreductase (POR), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
POR (GFP-tagged) - Human P450 (cytochrome) oxidoreductase (POR)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human P450 (cytochrome) oxidoreductase (POR), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, POR (Myc-DDK tagged) - Human P450 (cytochrome) oxidoreductase (POR), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human P450 (cytochrome) oxidoreductase (POR), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, POR (mGFP-tagged) - Human P450 (cytochrome) oxidoreductase (POR), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human P450 (cytochrome) oxidoreductase (POR), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 121.00
In Stock
POR HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 396.00
In Stock
Transient overexpression lysate of P450 (cytochrome) oxidoreductase (POR)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human P450 (cytochrome) oxidoreductase (POR), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
POR (untagged)-Human P450 (cytochrome) oxidoreductase (POR)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-POR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POR antibody: synthetic peptide directed towards the N terminal of human POR. Synthetic peptide located within the following region: IDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT |
Rabbit Polyclonal Anti-POR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POR antibody: synthetic peptide directed towards the middle region of human POR. Synthetic peptide located within the following region: VVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTE |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI5H5 (formerly 5H5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI6C4 (formerly 6C4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI5B3 (formerly 5B3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI5B6 (formerly 5B6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) POR mouse monoclonal antibody, clone OTI3F10 (formerly 3F10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
POR MS Standard C13 and N15-labeled recombinant protein (NP_000932)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
USD 379.00
In Stock
Anti-POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI3H10 (formerly 3H10), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI3H10 (formerly 3H10), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
Anti-POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI5H5 (formerly 5H5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI5H5 (formerly 5H5), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI5H5 (formerly 5H5), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI5H5 (formerly 5H5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI6C4 (formerly 6C4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI6C4 (formerly 6C4), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI6C4 (formerly 6C4), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI6C4 (formerly 6C4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI1B11 (formerly 1B11), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
POR (Cytochrome P450 Reductase) mouse monoclonal antibody, clone OTI1B11 (formerly 1B11), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |