Products

cDNA Clones (14)
Proteins (5)
Antibodies (2)
Jump to Filters
View as table Download
TAP1 (NM_000593) Human Tagged ORF Clone
RC204242

USD 420.00

In Stock

TAP1 (Myc-DDK-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TAP1 (NM_000593) Human Tagged ORF Clone Lentiviral Particle
RC204242L1V

USD 820.00

3 Weeks

Lenti ORF particles, TAP1 (Myc-DDK-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
TAP1 (NM_000593) Human Tagged ORF Clone Lentiviral Particle
RC204242L2V

USD 820.00

6 Weeks

Lenti ORF particles, TAP1 (mGFP-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
TAP1 (NM_000593) Human Tagged ORF Clone
RG204242

USD 460.00

In Stock

TAP1 (GFP-tagged) - Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TAP1 (NM_000593) Human Tagged ORF Clone
RC204242L3

USD 620.00

3 Weeks

Lenti-ORF clone of TAP1 (Myc-DDK-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAP1 (NM_000593) Human Tagged ORF Clone Lentiviral Particle
RC204242L3V

USD 820.00

11 Weeks

Lenti ORF particles, TAP1 (Myc-DDK-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAP1 (NM_000593) Human Tagged ORF Clone
RC204242L4

USD 620.00

3 Weeks

Lenti-ORF clone of TAP1 (mGFP-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAP1 (NM_000593) Human Tagged ORF Clone Lentiviral Particle
RC204242L4V

USD 820.00

11 Weeks

Lenti ORF particles, TAP1 (mGFP-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAP1 (NM_001292022) Human Tagged ORF Clone
RC238841

USD 570.00

3 Weeks

TAP1 (myc-DDK-tagged) - Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TAP1 (NM_000593) Human Untagged Clone
SC122568

USD 310.00

In Stock

TAP1 (untagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TAP1 (NM_000593) Human Tagged Lenti ORF Clone
RC204242L1

USD 768.00

In Stock

Lenti-ORF clone of TAP1 (Myc-DDK-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
TAP1 (NM_000593) Human Tagged ORF Clone
RC204242L2

USD 620.00

3 Weeks

Lenti-ORF clone of TAP1 (mGFP-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TAP1 Rabbit Polyclonal Antibody
TA332358

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL
TAP1 Goat Polyclonal Antibody
TA311131

USD 375.00

5 Days

Goat Anti-TAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKFREKLQEIKT, from the internal region of the protein sequence according to NP_000584.2.
TAP1 (NM_001292022) Human Tagged ORF Clone
RG238841

USD 610.00

2 Weeks

TAP1 (GFP-tagged) - Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TAP1 (NM_001292022) Human Untagged Clone
SC336735

USD 550.00

3 Weeks

TAP1 (untagged) - Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
TAP1 ICC Control Block
TB404242

USD 1,070.00

4 Weeks

Transient overexpression of TAP1 (NM_000593) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TAP1 ICC Control Block
TB438841

USD 1,220.00

4 Weeks

Transient overexpression of TAP1 (NM_001292022) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TAP1 Cytosection
TS404242

USD 225.00

4 Weeks

Transient overexpression of TAP1 (NM_000593) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TAP1 Cytosection
TS404242P5

USD 889.00

4 Weeks

Transient overexpression of TAP1 (NM_000593) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

TAP1 ICC Control Sections
TS438841P5

USD 889.00

4 Weeks

Transient overexpression of TAP1 (NM_001292022) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack