Products

cDNA Clones (35)
RNAi (12)
Gene Expression (11)
Proteins (5)
Antibodies (4)
Jump to Filters
View as table Download
Tap1 (NM_013683) Mouse Tagged ORF Clone
MR226873

USD 610.00

In Stock

Tap1 (Myc-DDK-tagged) - Mouse transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TAP1 (NM_000593) Human Tagged ORF Clone
RC204242

USD 420.00

In Stock

TAP1 (Myc-DDK-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TAP1 (NM_000593) Human Tagged ORF Clone Lentiviral Particle
RC204242L1V

USD 820.00

3 Weeks

Lenti ORF particles, TAP1 (Myc-DDK-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
TAP1 (NM_000593) Human Tagged ORF Clone Lentiviral Particle
RC204242L2V

USD 820.00

6 Weeks

Lenti ORF particles, TAP1 (mGFP-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
TAP1 (NM_000593) Human Tagged ORF Clone
RG204242

USD 460.00

In Stock

TAP1 (GFP-tagged) - Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TAP1 Human Gene Knockout Kit (CRISPR)
KN404242

USD 1,290.00

2 Weeks

TAP1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN404242 is the updated version of KN204242.
Tap1 Mouse Gene Knockout Kit (CRISPR)
KN517175

USD 1,290.00

2 Weeks

Tap1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN517175 is the updated version of KN317175.
Tap1 (NM_013683) Mouse Tagged ORF Clone
MG226873

USD 670.00

3 Weeks

Tap1 (GFP-tagged) - Mouse transporter 1 ATP-binding cassette sub-family B (MDR/TAP) (Tap1) transcript variant 1, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Tap1 (NM_001161730) Mouse Tagged ORF Clone
MG226877

USD 800.00

3 Weeks

Tap1 (GFP-tagged) - Mouse transporter 1 ATP-binding cassette sub-family B (MDR/TAP) (Tap1) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Tap1 (NM_013683) Mouse Tagged ORF Clone
MR226873L3

USD 810.00

3 Weeks

Lenti ORF clone of Tap1 (Myc-DDK-tagged) - Mouse transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tap1 (NM_013683) Mouse Tagged ORF Clone Lentiviral Particle
MR226873L3V

USD 1,010.00

6 Weeks

Lenti ORF particles, Tap1 (Myc-DDK-tagged) - Mouse transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tap1 (NM_013683) Mouse Tagged ORF Clone
MR226873L4

USD 810.00

3 Weeks

Lenti ORF clone of Tap1 (mGFP-tagged) - Mouse transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Tap1 (NM_013683) Mouse Tagged ORF Clone Lentiviral Particle
MR226873L4V

USD 1,010.00

6 Weeks

Lenti ORF particles, Tap1 (GFP-tagged) - Mouse transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Tap1 (NM_001161730) Mouse Tagged ORF Clone
MR226877

USD 730.00

4 Weeks

Tap1 (Myc-DDK-tagged) - Mouse transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Tap1 (NM_001161730) Mouse Tagged ORF Clone
MR226877L3

USD 930.00

4 Weeks

Lenti ORF clone of Tap1 (Myc-DDK-tagged) - Mouse transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tap1 (NM_001161730) Mouse Tagged ORF Clone Lentiviral Particle
MR226877L3V

USD 1,130.00

7 Weeks

Lenti ORF particles, Tap1 (Myc-DDK-tagged) - Mouse transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tap1 (NM_001161730) Mouse Tagged ORF Clone
MR226877L4

USD 930.00

4 Weeks

Lenti ORF clone of Tap1 (mGFP-tagged) - Mouse transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Tap1 (NM_001161730) Mouse Tagged ORF Clone Lentiviral Particle
MR226877L4V

USD 1,130.00

7 Weeks

Lenti ORF particles, Tap1 (GFP-tagged) - Mouse transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAP1 (NM_000593) Human Tagged ORF Clone
RC204242L3

USD 620.00

3 Weeks

Lenti-ORF clone of TAP1 (Myc-DDK-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAP1 (NM_000593) Human Tagged ORF Clone Lentiviral Particle
RC204242L3V

USD 820.00

11 Weeks

Lenti ORF particles, TAP1 (Myc-DDK-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAP1 (NM_000593) Human Tagged ORF Clone
RC204242L4

USD 620.00

3 Weeks

Lenti-ORF clone of TAP1 (mGFP-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAP1 (NM_000593) Human Tagged ORF Clone Lentiviral Particle
RC204242L4V

USD 820.00

11 Weeks

Lenti ORF particles, TAP1 (mGFP-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAP1 (NM_001292022) Human Tagged ORF Clone
RC238841

USD 570.00

3 Weeks

TAP1 (myc-DDK-tagged) - Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Tap1 (NM_032055) Rat Tagged ORF Clone
RR204474

USD 980.00

5 Weeks

Tap1 (Myc-DDK-tagged ORF) - Rat transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Tap1 (NM_032055) Rat Tagged ORF Clone
RR204474L3

USD 1,170.00

11 Weeks

Lenti ORF clone of Tap1 (Myc-DDK-tagged ORF) - Rat transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tap1 (NM_032055) Rat Tagged ORF Clone Lentiviral Particle
RR204474L3V

USD 1,390.00

15 Weeks

Lenti ORF particles, Tap1 (Myc-DDK-tagged ORF) - Rat transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tap1 (NM_032055) Rat Tagged ORF Clone
RR204474L4

USD 1,290.00

11 Weeks

Lenti ORF clone of Tap1 (mGFP-tagged ORF) - Rat transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Tap1 (NM_032055) Rat Tagged ORF Clone Lentiviral Particle
RR204474L4V

USD 1,560.00

15 Weeks

Lenti ORF particles, Tap1 (GFP-tagged ORF) - Rat transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAP1 (NM_000593) Human Untagged Clone
SC122568

USD 310.00

In Stock

TAP1 (untagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TAP1 (NM_000593) Human Tagged Lenti ORF Clone
RC204242L1

USD 768.00

In Stock

Lenti-ORF clone of TAP1 (Myc-DDK-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
TAP1 Human Gene Knockout Kit (CRISPR)
KN204242

USD 1,290.00

2 Weeks

TAP1 - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA GFP-puro
TAP1 (NM_000593) Human Tagged ORF Clone
RC204242L2

USD 620.00

3 Weeks

Lenti-ORF clone of TAP1 (mGFP-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TAP1 Rabbit Polyclonal Antibody
TA332358

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL
Tap1 Mouse shRNA Plasmid (Locus ID 21354)
TR502210

USD 715.00

In Stock

Tap1 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
TAP1 Goat Polyclonal Antibody
TA311131

USD 375.00

5 Days

Goat Anti-TAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKFREKLQEIKT, from the internal region of the protein sequence according to NP_000584.2.
Human TAP1 activation kit by CRISPRa
GA104748

USD 1,290.00

2 Weeks

TAP1 CRISPRa kit - CRISPR gene activation of human transporter 1, ATP binding cassette subfamily B member

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Tap1 activation kit by CRISPRa
GA204208

USD 1,290.00

2 Weeks

Tap1 CRISPRa kit - CRISPR gene activation of mouse transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
TAP1 Human qPCR Template Standard (NM_000593)
HK207210

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene TAP1

Application Plasmid of exact quantity for transcript copy number calculation
TAP1 Human qPCR Primer Pair (NM_000593)
HP200560

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene TAP1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
TAP1 Human Gene Knockout Kit (CRISPR)
KN204242BN

USD 1,290.00

4 Weeks

TAP1 - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA mBFP-Neo
TAP1 Human Gene Knockout Kit (CRISPR)
KN204242LP

USD 1,290.00

4 Weeks

TAP1 - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA Luciferase-Puro
TAP1 Human Gene Knockout Kit (CRISPR)
KN204242RB

USD 1,290.00

2 Weeks

TAP1 - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA RFP-BSD
Tap1 (NM_001161730) Mouse Untagged Clone
MC220580

USD 950.00

5 Weeks

Tap1 (untagged) - Mouse transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), transcript variant 2, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Tap1 (NM_013683) Mouse Untagged Clone
MC221090

USD 980.00

5 Weeks

Tap1 (untagged) - Mouse transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), transcript variant 1, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Tap1 Mouse qPCR Primer Pair (NM_013683)
MP217519

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Tap1

TAP1 (NM_001292022) Human Tagged ORF Clone
RG238841

USD 610.00

2 Weeks

TAP1 (GFP-tagged) - Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Tap1 (NM_032055) Rat Untagged Clone
RN204474

USD 980.00

6 Weeks

Tap1 (untagged ORF) - Rat transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (Tap1), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
TAP1 (NM_000593) Human 3' UTR Clone
SC205275

USD 560.00

4 Weeks

3`UTR clone of transporter 1 ATP-binding cassette sub-family B (MDR/TAP) (TAP1) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
TAP1 (NM_001292022) Human Untagged Clone
SC336735

USD 550.00

3 Weeks

TAP1 (untagged) - Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
TAP1 Human siRNA Oligo Duplex (Locus ID 6890)
SR321961

USD 430.00

2 Weeks

TAP1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

SR321961 is the updated version of SR304710.