Products

cDNA Clones (7)
Proteins (5)
Antibodies (1)
Jump to Filters
View as table Download
T2R50 (TAS2R50) (NM_176890) Human Tagged ORF Clone
RC211325

USD 420.00

In Stock

TAS2R50 (Myc-DDK-tagged)-Human taste receptor, type 2, member 50 (TAS2R50)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
T2R50 (TAS2R50) (NM_176890) Human Tagged ORF Clone
RG211325

USD 460.00

In Stock

TAS2R50 (GFP-tagged) - Human taste receptor, type 2, member 50 (TAS2R50)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
T2R50 (TAS2R50) (NM_176890) Human Tagged ORF Clone
RC211325L3

USD 620.00

3 Weeks

Lenti ORF clone of Human taste receptor, type 2, member 50 (TAS2R50), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
T2R50 (TAS2R50) (NM_176890) Human Tagged ORF Clone
RC211325L4

USD 620.00

3 Weeks

Lenti ORF clone of Human taste receptor, type 2, member 50 (TAS2R50), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
T2R50 (TAS2R50) Rabbit Polyclonal Antibody
TA333440

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAS2R50 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAS2R50 Antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R50. Synthetic peptide located within the following region: PFTLSLISFLMLICSLCKHLKKMQLHGEGSQDLSTKVHIKALQTLISFLL
T2R50 (TAS2R50) (NM_176890) Human Over-expression Lysate
LC406144

USD 121.00

2 Weeks

TAS2R50 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
T2R50 (TAS2R50) (NM_176890) Human Untagged Clone
SC307084

USD 660.00

3 Weeks

TAS2R50 (untagged)-Human taste receptor, type 2, member 50 (TAS2R50)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
T2R50 (TAS2R50) (NM_176890) ICC Control Block
TB411325

USD 1,070.00

4 Weeks

Transient overexpression of TAS2R50 (NM_176890) in HEK293T cells paraffin embedded controls for ICC/IHC staining

T2R50 (TAS2R50) Cytosection
TS411325

USD 225.00

4 Weeks

Transient overexpression of TAS2R50 (NM_176890) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

T2R50 (TAS2R50) Cytosection
TS411325P5

USD 889.00

4 Weeks

Transient overexpression of TAS2R50 (NM_176890) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack