Products

View as table Download

SH3KBP1 (2-14) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat
Immunogen Synthetic peptide from positions 2-14 of human SH3KBP1 (NP_114098.1)

Rabbit Polyclonal Anti-SH3KBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SH3KBP1 antibody: synthetic peptide directed towards the N terminal of human SH3KBP1. Synthetic peptide located within the following region: TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS

Rabbit Polyclonal Anti-SH3KBP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SH3KBP1