Products

View as table Download

Rabbit Polyclonal Anti-PTGDS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGDS antibody: synthetic peptide directed towards the N terminal of human PTGDS. Synthetic peptide located within the following region: MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS

Rabbit Polyclonal Antibody against PTGDS

Applications WB
Reactivities Human, Primate, Mouse, Rat, Bovine, Porcine, Feline, Equine, Dog
Conjugation Unconjugated
Immunogen The epitope recognized by this antibody maps to region within residue 1-50 of human PTGDS. [Swiss-Prot# P41222]

Rabbit Polyclonal Antibody against PTGDS

Applications WB
Reactivities Human, Feline, Bovine, Rabbit, Dog, Rat, Mouse, Primate
Conjugation Unconjugated
Immunogen The epitope recognized by this antibody maps to region within residue 120-190 of human PTGDS. [Swiss-Prot# P41222]

Anti-PTGDS Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 64-325 amino acids of human prostaglandin D2 synthase 21kDa (brain)prostaglandin D2 synthase 21kDa (brain)

Anti-PTGDS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 64-325 amino acids of human prostaglandin D2 synthase 21kDa (brain)prostaglandin D2 synthase 21kDa (brain)

Anti-PTGDS Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-190 amino acids of human prostaglandin D2 synthase 21kDa (brain)