Products

View as table Download

Rabbit polyclonal PTTG2 Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PTTG2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 56-84 amino acids from the Central region of human PTTG2.

Rabbit Polyclonal Anti-PTTG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTTG2 antibody: synthetic peptide directed towards the middle region of human PTTG2. Synthetic peptide located within the following region: DAPSALPKATRKALGTVNRATEKSVKTNGPRKQKQPSFSAKKMTEKTVKT