Securin 2 (PTTG2) Rabbit Polyclonal Antibody

CAT#: TA339704

Rabbit Polyclonal Anti-PTTG2 Antibody

Product Images

WB Suggested Anti-PTTG2 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PTTG2 antibody: synthetic peptide directed towards the middle region of human PTTG2. Synthetic peptide located within the following region: DAPSALPKATRKALGTVNRATEKSVKTNGPRKQKQPSFSAKKMTEKTVKT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: pituitary tumor-transforming 2
• Database Link:
  NP_006598
  Entrez Gene 10744 Human
  UniProt ID Q9NZH5
• Background: PTTG2 belongs to the securin family. The N-terminal destruction box (D-box) acts as a recognition signal for degradation via the ubiquitin-proteasome pathway.
• Synonyms: PTTG2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Bovine: 92%; Horse: 86%; Mouse: 86%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Oocyte meiosis