Products

Jump to Filters
View as table Download
HIPK1 Rabbit Polyclonal Antibody
TA342143

USD 375.00

5 Days

Rabbit polyclonal Anti-HIPK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HIPK1 antibody: synthetic peptide directed towards the middle region of human HIPK1. Synthetic peptide located within the following region: PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS
HIPK1 Rabbit Polyclonal Antibody
TA351247

USD 345.00

In Stock

Rabbit Polyclonal Anti-HIPK1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HIPK1
HIPK1 Rabbit Polyclonal Antibody
TA367079

USD 380.00

4 Weeks

HIPK1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HIPK1