Products

Jump to Filters
View as table Download
OIF (OGN) Rabbit Monoclonal Antibody [Clone ID: OTIR4H1]
TA591025

USD 428.00

In Stock

Rabbit monoclonal anti-MIME antibody for SISCAPA, clone OTIR4H1

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Ogn Rabbit Polyclonal Antibody
TA346479

USD 475.00

5 Days

Rabbit Polyclonal Anti-Ogn Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ogn antibody is: synthetic peptide directed towards the C-terminal region of Rat Ogn. Synthetic peptide located within the following region: LQFNSISSITDDTFCKANDTRYIRERMEEIRLEGNPIALGKHPNSFICLK
OIF (OGN) Rabbit Polyclonal Antibody
TA379455

USD 220.00

3 Weeks

OGN Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-298 of human OGN (NP_148935.1).
Modifications Unmodified