Products

View as table Download

BMP5 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BMP5

Rabbit Polyclonal Anti-BMP5 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Bmp5 antibody is: synthetic peptide directed towards the C-terminal region of Rat Bmp5. Synthetic peptide located within the following region: NKSSSHQDPSRIPSAGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEG

BMP5 Rabbit Polyclonal (aa31-46) Antibody

Applications IHC
Reactivities Human
Immunogen BMP5 antibody was raised against synthetic peptide from human BMP5.

Rabbit polyclonal anti-BMP-5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant human BMP-5

Rabbit polyclonal anti-BMP-5 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 29 of human BMP-5

BMP5 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BMP5

BMP5 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 317-454 of human BMP5 (NP_066551.1).
Modifications Unmodified