Germany
Japan
United Kingdom
China
BMP5 (Myc-DDK-tagged)-Human bone morphogenetic protein 5 (BMP5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, BMP5 (Myc-DDK tagged) - Human bone morphogenetic protein 5 (BMP5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, BMP5 (mGFP-tagged) - Human bone morphogenetic protein 5 (BMP5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Bmp5 (Myc-DDK-tagged) - Mouse bone morphogenetic protein 5 (Bmp5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BMP5 (GFP-tagged) - Human bone morphogenetic protein 5 (BMP5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BMP5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN406456 is the updated version of KN206456.
Bmp5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN502198 is the updated version of KN302198.
Bmp5 (GFP-tagged) - Mouse bone morphogenetic protein 5 (Bmp5), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Bmp5 (Myc-DDK-tagged) - Mouse bone morphogenetic protein 5 (Bmp5)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bmp5 (Myc-DDK-tagged) - Mouse bone morphogenetic protein 5 (Bmp5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Bmp5 (mGFP-tagged) - Mouse bone morphogenetic protein 5 (Bmp5)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bmp5 (GFP-tagged) - Mouse bone morphogenetic protein 5 (Bmp5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human bone morphogenetic protein 5 (BMP5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BMP5 (Myc-DDK tagged) - Human bone morphogenetic protein 5 (BMP5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human bone morphogenetic protein 5 (BMP5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BMP5 (mGFP-tagged) - Human bone morphogenetic protein 5 (BMP5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Bmp5 (Myc-DDK-tagged ORF) - Rat bone morphogenetic protein 5 (Bmp5), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Bmp5 (Myc-DDK-tagged ORF) - Rat bone morphogenetic protein 5 (Bmp5), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bmp5 (Myc-DDK-tagged ORF) - Rat bone morphogenetic protein 5 (Bmp5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Bmp5 (mGFP-tagged ORF) - Rat bone morphogenetic protein 5 (Bmp5), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bmp5 (GFP-tagged ORF) - Rat bone morphogenetic protein 5 (Bmp5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human bone morphogenetic protein 5 (BMP5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human bone morphogenetic protein 5 (BMP5).
| Tag | Tag Free |
| Expression Host | CHO |
Bmp5 (untagged) - Mouse bone morphogenetic protein 5 (Bmp5), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
BMP5 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human BMP5 |
BMP5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of bone morphogenetic protein 5 (BMP5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human bone morphogenetic protein 5 (BMP5), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
BMP5 (untagged)-Human bone morphogenetic protein 5 (BMP5)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
BMP5 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Rabbit Polyclonal Anti-BMP5 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Bmp5 antibody is: synthetic peptide directed towards the C-terminal region of Rat Bmp5. Synthetic peptide located within the following region: NKSSSHQDPSRIPSAGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEG |
BMP5 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Rabbit polyclonal anti-BMP-5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant human BMP-5 |
Rabbit polyclonal anti-BMP-5 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 29 of human BMP-5 |
BMP5 (317-454) human recombinant protein, 0.5 mg
| Expression Host | E. coli |
BMP5 (317-454) human recombinant protein, 0.1 mg
| Expression Host | E. coli |
Human BMP-5 ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human BMP-5 |
| Reactivities | Human |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine BMP-5. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Bovine BMP5 |
| Format | 8x12 divisible strips |
| Reactivities | Bovine |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of Dog Caninea BMP-5. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Canine BMP5 |
| Format | 8x12 divisible strips |
| Reactivities | Canine |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of horse equine BMP-5. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Equine BMP5 |
| Format | 8x12 divisible strips |
| Reactivities | Equine |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of Pig porcine BMP-5. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Pig BMP5 |
| Format | 8x12 divisible strips |
| Reactivities | Pig |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of monkey primate BMP-5. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Monkey BMP5 |
| Format | 8x12 divisible strips |
| Reactivities | Monkey |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of rabbit BMP-5. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Rabbit BMP5 |
| Format | 8x12 divisible strips |
| Reactivities | Rabbit |
BMP5 CRISPRa kit - CRISPR gene activation of human bone morphogenetic protein 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Bmp5 CRISPRa kit - CRISPR gene activation of mouse bone morphogenetic protein 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene BMP5
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene BMP5
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qSTAR qPCR primer pairs against Mus musculus gene Bmp5
Active filters
Target Symbol
- BMP5