Products

View as table Download

CEBPB rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CEBPB

Rabbit Polyclonal Anti-CEBPB Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CEBPB antibody: synthetic peptide directed towards the N terminal of human CEBPB. Synthetic peptide located within the following region: AIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDL

Rabbit Polyclonal C/EBP- beta (Thr235/188) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human C/EBP- beta around the phosphorylation site of Threonine 235/188
Modifications Phospho-specific

Rabbit Polyclonal Anti-CEBPB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CEBPB Antibody: A synthesized peptide derived from human CEBPB

Rabbit polyclonal C/EBP-beta (Ab-235/188) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human C/EBP-β around the phosphorylation site of threonine 235 (P-G-T-P-S).

Rabbit Polyclonal C/EBP-beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human C/EBP-beta

Rabbit polyclonal anti-CEBPB antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CEBPB.

Anti-CEBPB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.336~340(E-P-L-L-A) derived from Human C/EBPβ.

Rabbit Polyclonal anti-CEBPB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CEBPB antibody: synthetic peptide directed towards the C terminal of human CEBPB. Synthetic peptide located within the following region: ADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKS

Rabbit Polyclonal Anti-CEBPB Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CEBPB

CEBPB rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CEBPB

C/EBPB Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human C/EBPB (NP_005185.2).
Modifications Unmodified

Phospho-C/EBPB-T235 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T235 of human C/EBPB.
Modifications Phospho T235