Rabbit Polyclonal MBD1 Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD1 antibody: human MBD1 (Methyl-CpG-binding domain protein 1), using a KLH-conjugated synthetic peptide containing a sequence from the N-terminal part of the protein. |
Rabbit Polyclonal Anti-MBD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD1 antibody: synthetic peptide directed towards the C terminal of human MBD1. Synthetic peptide located within the following region: VKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRD |
Rabbit Polyclonal Anti-MBD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD1 antibody: synthetic peptide directed towards the middle region of human MBD1. Synthetic peptide located within the following region: CKVWETEDTVEPTSTSWNPRGWPGTHVSLSPPPASMMWVSCRRSWCPSSQ |
Rabbit polyclonal anti-MBD1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 594 of human MBD1 |
Rabbit Polyclonal Anti-MBD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD1 antibody: synthetic peptide directed towards the C terminal of human MBD1. Synthetic peptide located within the following region: NKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKP |
Rabbit Polyclonal anti-MBD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MBD1 |
Rabbit Polyclonal anti-MBD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MBD1 |
Germany
Japan
United Kingdom
China
