Products

Jump to Filters
View as table Download
MCEE Rabbit Polyclonal Antibody
TA342914

USD 375.00

5 Days

Rabbit Polyclonal Anti-MCEE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCEE antibody: synthetic peptide directed towards the C terminal of human MCEE. Synthetic peptide located within the following region: DSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAH
MCEE Rabbit Polyclonal Antibody
TA378390

USD 220.00

3 Weeks

MCEE Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human MCEE (NP_115990.3).
Modifications Unmodified