Rabbit Polyclonal Anti-PLP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLP1 antibody: synthetic peptide directed towards the N terminal of human PLP1. Synthetic peptide located within the following region: GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL |
Rabbit Polyclonal Anti-PLP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLP1 antibody: synthetic peptide directed towards the middle region of human PLP1. Synthetic peptide located within the following region: IYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ |
PLP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 145-210 of human PLP1 (NP_955772.1). |
| Modifications | Unmodified |
PLP1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 145-210 of human PLP1 (NP_955772.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
