Germany
Japan
United Kingdom
China
PLP1 (Myc-DDK-tagged)-Human proteolipid protein 1 (PLP1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PLP1 (Myc-DDK-tagged)-Human proteolipid protein 1 (PLP1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
PLP1 (Myc-DDK-tagged)-Human proteolipid protein 1 (PLP1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Plp1 (Myc-DDK-tagged) - Mouse proteolipid protein (myelin) 1 (Plp1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Plp1 (GFP-tagged) - Mouse proteolipid protein (myelin) 1 (Plp1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PLP1 (GFP-tagged) - Human proteolipid protein 1 (PLP1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PLP1 (GFP-tagged) - Human proteolipid protein 1 (PLP1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PLP1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN418616 is the updated version of KN218616.
Plp1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513486 is the updated version of KN313486.
Lenti ORF clone of Plp1 (Myc-DDK-tagged) - Mouse proteolipid protein (myelin) 1 (Plp1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Plp1 (Myc-DDK-tagged) - Mouse proteolipid protein (myelin) 1 (Plp1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Plp1 (mGFP-tagged) - Mouse proteolipid protein (myelin) 1 (Plp1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Plp1 (GFP-tagged) - Mouse proteolipid protein (myelin) 1 (Plp1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Plp1 (myc-DDK-tagged) - Mouse proteolipid protein (myelin) 1 (Plp1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Plp1 (myc-DDK-tagged) - Mouse proteolipid protein (myelin) 1 (Plp1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human proteolipid protein 1 (PLP1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PLP1 (Myc-DDK tagged) - Human proteolipid protein 1 (PLP1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human proteolipid protein 1 (PLP1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PLP1 (mGFP-tagged) - Human proteolipid protein 1 (PLP1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human proteolipid protein 1 (PLP1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PLP1 (Myc-DDK tagged) - Human proteolipid protein 1 (PLP1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human proteolipid protein 1 (PLP1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PLP1 (mGFP-tagged) - Human proteolipid protein 1 (PLP1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human proteolipid protein 1 (PLP1), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PLP1 (Myc-DDK tagged) - Human proteolipid protein 1 (PLP1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human proteolipid protein 1 (PLP1), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PLP1 (mGFP-tagged) - Human proteolipid protein 1 (PLP1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PLP1 (GFP-tagged) - Human proteolipid protein 1 (PLP1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Plp1 (Myc-DDK-tagged ORF) - Rat proteolipid protein 1 (Plp1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Plp1 (Myc-DDK-tagged ORF) - Rat proteolipid protein 1 (Plp1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Plp1 (Myc-DDK-tagged ORF) - Rat proteolipid protein 1 (Plp1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Plp1 (mGFP-tagged ORF) - Rat proteolipid protein 1 (Plp1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Plp1 (GFP-tagged ORF) - Rat proteolipid protein 1 (Plp1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PLP1 (untagged)-Human proteolipid protein 1 (PLP1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PLP1 chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH conjugated corresponding to a sequence shared between the Mouse (P60202) and Human (NP_000524) gene products. Production: After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks, and then affinity-purified using a peptide column. The concentrations of the eluates were then adjusted to 0.1 mg/ml, and the preparation was filter-sterilized. |
PLP1 (untagged)-Human proteolipid protein 1 (PLP1), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PLP1 (C-term) mouse monoclonal antibody, clone plpc1, Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Bovine, Human |
Transient overexpression lysate of proteolipid protein 1 (PLP1), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of proteolipid protein 1 (PLP1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Plp1 (untagged) - Mouse proteolipid protein (myelin) 1 (Plp1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Plp1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Rabbit Polyclonal Anti-PLP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLP1 antibody: synthetic peptide directed towards the N terminal of human PLP1. Synthetic peptide located within the following region: GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL |
Rabbit Polyclonal Anti-PLP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLP1 antibody: synthetic peptide directed towards the middle region of human PLP1. Synthetic peptide located within the following region: IYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ |
qSTAR qPCR primer pairs against Homo sapiens gene PLP1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Transient overexpression lysate of proteolipid protein 1 (PLP1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Plp1
PLP1 CRISPRa kit - CRISPR gene activation of human proteolipid protein 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PLP1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene PLP1
| Application | Plasmid of exact quantity for transcript copy number calculation |
PLP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Active filters
Target Symbol
- PLP1