Products

View as table Download

Rabbit polyclonal SLC11A2 Antibody (Center)

Applications IF, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2.

Rabbit Polyclonal Anti-SLC11A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC11A2 Antibody: synthetic peptide directed towards the N terminal of human SLC11A2. Synthetic peptide located within the following region: VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF

SLC11A2 / DMT1 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Gorilla, Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen SLC11A2 / DMT1 antibody was raised against synthetic 16 amino acid peptide from internal region of human SLC11A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Galago, Rat, Hamster, Bovine, Horse (94%); Mouse, Elephant (88%); Dog, Bat, Rabbit, Pig, Guinea pig (81%).

SLC11A2 / DMT1 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Human
Conjugation Unconjugated
Immunogen SLC11A2 / DMT1 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human SLC11A2. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey, Bovine, Elephant, Pig (93%); Dog, Rabbit (87%); Marmoset, Panda (80%).

Rabbit Polyclonal Anti-SLC11A2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC11A2

SLC11A2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC11A2

DMT1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DMT1 (NP_000608.1).
Modifications Unmodified