Products

View as table Download

Rabbit Polyclonal Anti-SUZ12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUZ12 antibody: synthetic peptide directed towards the C terminal of human SUZ12. Synthetic peptide located within the following region: ESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL

Rabbit Polyclonal SUZ12 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen SUZ12 antibody was raised against a 19 amino acid peptide near the center of human SUZ12.

Rabbit Polyclonal Anti-SUZ12 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUZ12 antibody: synthetic peptide directed towards the middle region of human SUZ12. Synthetic peptide located within the following region: TGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQ

Rabbit Polyclonal SUZ12 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Anti-SUZ12 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide (KLH-coupled) derived from human SUZ12

SUZ12 Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 470-739 of human SUZ12 (NP_056170.2).
Modifications Unmodified