Products

Antibodies (146)
cDNA Clones (112)
Proteins (74)
Jump to Filters
View as table Download
MTHFR (NM_005957) Human Tagged ORF Clone
RC208588L3

USD 620.00

3 Weeks

Lenti ORF clone of Human methylenetetrahydrofolate reductase (NAD(P)H) (MTHFR), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MTHFR (NM_005957) Human Tagged ORF Clone Lentiviral Particle
RC208588L3V

USD 820.00

7 Weeks

Lenti ORF particles, MTHFR (Myc-DDK tagged) - Human methylenetetrahydrofolate reductase (NAD(P)H) (MTHFR), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MTHFR (NM_005957) Human Tagged ORF Clone
RC208588L4

USD 620.00

3 Weeks

Lenti ORF clone of Human methylenetetrahydrofolate reductase (NAD(P)H) (MTHFR), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MTHFR (NM_005957) Human Tagged ORF Clone Lentiviral Particle
RC208588L4V

USD 820.00

7 Weeks

Lenti ORF particles, MTHFR (mGFP-tagged) - Human methylenetetrahydrofolate reductase (NAD(P)H) (MTHFR), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT2 (NM_001166359) Human Tagged ORF Clone
RC230153

USD 530.00

3 Weeks

SHMT2 (Myc-DDK-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SHMT2 (NM_001166359) Human Tagged ORF Clone
RC230153L3

USD 730.00

8 Weeks

Lenti-ORF clone of SHMT2 (Myc-DDK-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT2 (NM_001166359) Human Tagged ORF Clone Lentiviral Particle
RC230153L3V

USD 930.00

11 Weeks

Lenti ORF particles, SHMT2 (Myc-DDK-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT2 (NM_001166359) Human Tagged ORF Clone
RC230153L4

USD 730.00

8 Weeks

Lenti-ORF clone of SHMT2 (mGFP-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT2 (NM_001166359) Human Tagged ORF Clone Lentiviral Particle
RC230153L4V

USD 930.00

11 Weeks

Lenti ORF particles, SHMT2 (mGFP-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT2 (NM_001166357) Human Tagged ORF Clone
RC230154

USD 530.00

3 Weeks

SHMT2 (Myc-DDK-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SHMT2 (NM_001166357) Human Tagged ORF Clone
RC230154L3

USD 730.00

3 Weeks

Lenti-ORF clone of SHMT2 (Myc-DDK-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT2 (NM_001166357) Human Tagged ORF Clone Lentiviral Particle
RC230154L3V

USD 930.00

6 Weeks

Lenti ORF particles, SHMT2 (Myc-DDK-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT2 (NM_001166357) Human Tagged ORF Clone Lentiviral Particle
RC230154L4V

USD 930.00

3 Weeks

Lenti ORF particles, SHMT2 (mGFP-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT2 (NM_001166358) Human Tagged ORF Clone
RC230155

USD 530.00

3 Weeks

SHMT2 (Myc-DDK-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SHMT2 (NM_001166358) Human Tagged ORF Clone
RC230155L3

USD 730.00

8 Weeks

Lenti-ORF clone of SHMT2 (Myc-DDK-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT2 (NM_001166358) Human Tagged ORF Clone Lentiviral Particle
RC230155L3V

USD 930.00

11 Weeks

Lenti ORF particles, SHMT2 (Myc-DDK-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT2 (NM_001166358) Human Tagged ORF Clone
RC230155L4

USD 730.00

8 Weeks

Lenti-ORF clone of SHMT2 (mGFP-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT2 (NM_001166358) Human Tagged ORF Clone Lentiviral Particle
RC230155L4V

USD 930.00

11 Weeks

Lenti ORF particles, SHMT2 (mGFP-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT2 (NM_001166356) Human Tagged ORF Clone
RC230172

USD 520.00

3 Weeks

SHMT2 (Myc-DDK-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SHMT2 (NM_001166356) Human Tagged ORF Clone
RC230172L3

USD 720.00

8 Weeks

Lenti-ORF clone of SHMT2 (Myc-DDK-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT2 (NM_001166356) Human Tagged ORF Clone Lentiviral Particle
RC230172L3V

USD 920.00

11 Weeks

Lenti ORF particles, SHMT2 (Myc-DDK-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT2 (NM_001166356) Human Tagged ORF Clone
RC230172L4

USD 720.00

8 Weeks

Lenti-ORF clone of SHMT2 (mGFP-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT2 (NM_001166356) Human Tagged ORF Clone Lentiviral Particle
RC230172L4V

USD 920.00

11 Weeks

Lenti ORF particles, SHMT2 (mGFP-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT1 (NM_001281786) Human Tagged ORF Clone
RC237604

USD 420.00

2 Weeks

SHMT1 (myc-DDK-tagged) - Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
MTHFR (NM_005957) Human Tagged ORF Clone
RG208588

USD 460.00

3 Weeks

MTHFR (GFP-tagged) - Human methylenetetrahydrofolate reductase (NAD(P)H) (MTHFR)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SHMT2 (NM_001166359) Human Tagged ORF Clone
RG230153

USD 580.00

3 Weeks

SHMT2 (GFP-tagged) - Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SHMT2 (NM_001166357) Human Tagged ORF Clone
RG230154

USD 580.00

3 Weeks

SHMT2 (GFP-tagged) - Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SHMT2 (NM_001166358) Human Tagged ORF Clone
RG230155

USD 580.00

3 Weeks

SHMT2 (GFP-tagged) - Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SHMT2 (NM_001166356) Human Tagged ORF Clone
RG230172

USD 570.00

3 Weeks

SHMT2 (GFP-tagged) - Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SHMT2 Rabbit Polyclonal Antibody
TA327002

USD 380.00

3 Weeks

Rabbit anti-SHMT2 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SHMT2
Peroxiredoxin 6 (PRDX6) Rabbit Polyclonal Antibody
TA327232

USD 275.00

3 Weeks

Rabbit anti-PRDX6 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRDX6
ADH5 (NM_000671) Human Untagged Clone
SC119755

USD 310.00

In Stock

ADH5 (untagged)-Human alcohol dehydrogenase 5 (class III), chi polypeptide (ADH5)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SHMT2 (NM_001166357) Human Tagged Lenti ORF Clone
RC230154L4

USD 900.00

In Stock

Lenti-ORF clone of SHMT2 (mGFP-tagged)-Human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MTHFR (NM_005957) Human Tagged ORF Clone
RC208588L1

USD 768.00

In Stock

Lenti ORF clone of Human methylenetetrahydrofolate reductase (NAD(P)H) (MTHFR), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ADH5 Rabbit Polyclonal Antibody
TA321174

USD 345.00

4 Weeks

Anti-ADH5 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Peroxiredoxin 6 (PRDX6) (NM_004905) Human Tagged ORF Clone Lentiviral Particle
RC207780L4V

USD 1,020.00

3 Weeks

Lenti ORF particles, PRDX6 (mGFP-tagged) - Human peroxiredoxin 6 (PRDX6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT1 (NM_004169) Human Tagged ORF Clone
RC203461L1

USD 768.00

In Stock

Lenti ORF clone of Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ADH5 (NM_000671) Human Tagged ORF Clone
RC204903L1

USD 768.00

In Stock

Lenti ORF clone of Human alcohol dehydrogenase 5 (class III), chi polypeptide (ADH5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SHMT1 (NM_148918) Human Tagged ORF Clone
RC205102L4

USD 768.00

In Stock

Lenti ORF clone of Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Peroxiredoxin 6 (PRDX6) (NM_004905) Human Untagged Clone
SC117092

USD 310.00

In Stock

PRDX6 (untagged)-Human peroxiredoxin 6 (PRDX6)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Peroxiredoxin 6 (PRDX6) Rabbit Polyclonal Antibody
TA346592

USD 475.00

5 Days

Rabbit Polyclonal Anti-PRDX6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the C terminal of human PRDX6. Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
SHMT2 (NM_005412) Human Recombinant Protein
TP760127

USD 215.00

In Stock

Recombinant protein of human serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), nuclear gene encoding mitochondrial protein, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli