Rabbit polyclonal Anti-Rpl17 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rpl17 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLK |
Rabbit polyclonal Anti-Rpl17 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rpl17 antibody is: synthetic peptide directed towards the C-terminal region of Rat Rpl17. Synthetic peptide located within the following region: APKMRRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKIS |
RPL17 CRISPRa kit - CRISPR gene activation of human ribosomal protein L17
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Rpl17 CRISPRa kit - CRISPR gene activation of mouse ribosomal protein L17
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene RPL17
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene RPL17
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
RPL17 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Rpl17
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Rpl17
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Rpl17 (untagged ORF) - Rat ribosomal protein L17 (Rpl17), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
RPL17 (untagged)-Human ribosomal protein L17 (RPL17), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
RPL17 (untagged) - Homo sapiens ribosomal protein L17 (RPL17), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
RPL17 (untagged) - Homo sapiens ribosomal protein L17 (RPL17), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
RPL17 (untagged) - Homo sapiens ribosomal protein L17 (RPL17), transcript variant 5
| Vector | pCMV6 series |
| Tag | Tag Free |
RPL17 (untagged) - Homo sapiens ribosomal protein L17 (RPL17), transcript variant 6
| Vector | pCMV6 series |
| Tag | Tag Free |
RPL17 (untagged) - Homo sapiens ribosomal protein L17 (RPL17), transcript variant 7
| Vector | pCMV6 series |
| Tag | Tag Free |
RPL17 (untagged) - Homo sapiens ribosomal protein L17 (RPL17), transcript variant 8
| Vector | pCMV6 series |
| Tag | Tag Free |
RPL17 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rpl17 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rpl17 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
RPL17 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPL17 |
RPL17 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human RPL17 (NP_000976.1). |
| Modifications | Unmodified |
Transient overexpression of RPL17 (NM_000985) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RPL17 (NM_001035006) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RPL17 (NM_001199345) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RPL17 (NM_001199340) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RPL17 (NM_001199341) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RPL17 (NM_001199342) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RPL17 (NM_001199343) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RPL17 (NM_001199344) in HEK293T cells paraffin embedded controls for ICC/IHC staining
RPL17 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Rpl17 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Rpl17 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
RPL17 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Rpl17 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of RPL17 (NM_000985) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RPL17 (NM_000985) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RPL17 (NM_001035006) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RPL17 (NM_001035006) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RPL17 (NM_001199345) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RPL17 (NM_001199340) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RPL17 (NM_001199340) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RPL17 (NM_001199341) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RPL17 (NM_001199341) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RPL17 (NM_001199342) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RPL17 (NM_001199342) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RPL17 (NM_001199343) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RPL17 (NM_001199343) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RPL17 (NM_001199344) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Germany
Japan
United Kingdom
China
