Products

cDNA Clones (97)
Antibodies (48)
Proteins (33)
Jump to Filters
View as table Download
G protein alpha S (GNAS) (164-394) Rabbit Polyclonal Antibody
AP23581PU-N

USD 440.00

2 Weeks

G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS
G protein alpha S (GNAS) (NM_016592) Human Over-expression Lysate
LC402577

USD 121.00

In Stock

GNAS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
G protein alpha S (GNAS) (NM_080426) Human Over-expression Lysate
LC409171

USD 121.00

In Stock

GNAS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
G protein alpha S (GNAS) (NM_001077488) Human Over-expression Lysate
LC421439

USD 121.00

In Stock

GNAS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
G protein alpha S (GNAS) (NM_001077489) Human Over-expression Lysate
LC421440

USD 121.00

In Stock

GNAS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
G protein alpha S (GNAS) (NM_000516) Human Over-expression Lysate
LC424674

USD 121.00

In Stock

GNAS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
G protein alpha S (GNAS) (NM_080426) Human Over-expression Lysate
LY409171

USD 396.00

In Stock

Transient overexpression lysate of GNAS complex locus (GNAS), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
G protein alpha S (GNAS) (NM_001077488) Human Over-expression Lysate
LY421439

USD 396.00

In Stock

Transient overexpression lysate of GNAS complex locus (GNAS), transcript variant 6

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
G protein alpha S (GNAS) (NM_001077489) Human Over-expression Lysate
LY421440

USD 396.00

In Stock

Transient overexpression lysate of GNAS complex locus (GNAS), transcript variant 7

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA308888

USD 415.00

5 Days

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2)
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA329505

USD 310.00

5 Days

Rabbit Polyclonal anti-GNAS antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
AP17431PU-N

USD 450.00

2 Weeks

G protein alpha S (GNAS) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human GNAS
G protein alpha S (GNAS) Goat Polyclonal Antibody
TA311129

USD 375.00

5 Days

Goat Anti-GNAS Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-QAARSNSDGEKATK, from the internal region of the protein sequence according to NP_000507.1; NP_001070956.1; NP_001070957.1.
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA329504

USD 375.00

5 Days

Rabbit Polyclonal anti-GNAS antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD
G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI7A6]
CF809270

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI7A6

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI13D7]
CF809271

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI13D7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI12D9]
CF809313

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI12D9

Applications WB
Reactivities Human
Conjugation Unconjugated
G protein alpha S (GNAS) (NM_000516) Human Mass Spec Standard
PH314197

USD 2,055.00

3 Weeks

GNAS MS Standard C13 and N15-labeled recombinant protein (NP_000507)

Tag C-Myc/DDK
Expression Host HEK293
G protein alpha S (GNAS) (NM_080426) Human Mass Spec Standard
PH314318

USD 2,055.00

3 Weeks

GNAS MS Standard C13 and N15-labeled recombinant protein (NP_536351)

Tag C-Myc/DDK
Expression Host HEK293
G protein alpha S (GNAS) (NM_001077489) Human Mass Spec Standard
PH316883

USD 2,055.00

3 Weeks

GNAS MS Standard C13 and N15-labeled recombinant protein (NP_001070957)

Tag C-Myc/DDK
Expression Host HEK293
G protein alpha S (GNAS) (NM_001077489) Human Untagged Clone
SC315542

USD 650.00

3 Weeks

GNAS (untagged)-Human GNAS complex locus (GNAS), transcript variant 7

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
G protein alpha S (GNAS) (NM_001077488) Human Untagged Clone
SC315545

USD 670.00

3 Weeks

GNAS (untagged)-Human GNAS complex locus (GNAS), transcript variant 6

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA323636

USD 345.00

In Stock

Anti-GNAS Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA323637

USD 345.00

In Stock

Anti-GNAS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus
G protein alpha S (GNAS) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13D7]
TA809271AM

USD 420.00

4 Weeks

GNAS mouse monoclonal antibody,clone OTI13D7, Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
G protein alpha S (GNAS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI13D7]
TA809271BM

USD 420.00

4 Weeks

GNAS mouse monoclonal antibody,clone OTI13D7, HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP