Germany
Japan
United Kingdom
China
Lenti ORF particles, TCF7L2 (Myc-DDK-tagged)-Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 10, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Products
View as table DownloadLenti-ORF clone of TCF7L2 (mGFP-tagged)-Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 10
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TCF7L2 (mGFP-tagged)-Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 10, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 13, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TCF7L2 (Myc-DDK tagged) - Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 13, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 13, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TCF7L2 (mGFP-tagged) - Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 13, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 7, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TCF7L2 (Myc-DDK tagged) - Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 7, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 7, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TCF7L2 (mGFP-tagged) - Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 7, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TCF7L2 (Myc-DDK tagged) - Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 9
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (Myc-DDK tagged) - Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 11
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (Myc-DDK tagged) - Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 8
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (GFP-tagged) - Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 6
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (GFP-tagged) - Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (GFP-tagged) - Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (GFP-tagged) - Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (GFP-tagged) - Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 12
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (GFP-tagged) - Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 10
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (GFP-tagged) - Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 13
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (GFP-tagged) - Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 7
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (GFP-tagged) - Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 9
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (GFP-tagged) - Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 11
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L2 (GFP-tagged) - Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 8
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tcf7l2 (myc-DDK-tagged) - Rat transcription factor 7-like 2 (T-cell specific, HMG-box) (Tcf7l2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Tcf7l2 (Myc-DDK-tagged) - Mouse transcription factor 7-like 2, T-cell specific, HMG-box (Tcf7l2), transcript variant 1
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
TCF7L2 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
TCF7L2 (untagged)-Human transcription factor 7-like 2 (T-cell specific HMG-box) (TCF7L2) transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-TCF7L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Transient overexpression lysate of transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 6, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
TCF7L2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Tcf7l2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
TCF7L2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Tcf7l2 (mGFP-tagged) - Mouse transcription factor 7-like 2, T-cell specific, HMG-box (Tcf7l2), transcript variant 1
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 6, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
3`UTR clone of transcription factor 7-like 2 (T-cell specific HMG-box) (TCF7L2) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
TCF7L2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TCF7L2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TCF7L2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TCF7L2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TCF7L2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TCF7L2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Active filters
Target Symbol
- TCF7L2
Filter by
Species
Antibody Hosts
Clonalities
Conjugates
Expression Hosts
Lentivirus
Vectors
Mutants
Mammalian Cell Selection
Pathways
- Acute myeloid leukemia (140)
- Adherens junction (140)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (140)
- Basal cell carcinoma (140)
- Colorectal cancer (140)
- Endometrial cancer (140)
- Melanogenesis (140)
- Pathways in cancer (140)
- Prostate cancer (140)
- Thyroid cancer (140)
- Wnt signaling pathway (140)