Products

cDNA Clones (14)
Proteins (4)
Antibodies (1)
Jump to Filters
View as table Download
ABCA5 (NM_018672) Human Tagged ORF Clone
RC213865

USD 1,720.00

2 Weeks

ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCA5 (NM_018672) Human Tagged ORF Clone
RC213865L3

USD 1,920.00

10 Weeks

Lenti-ORF clone of ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_018672) Human Tagged ORF Clone Lentiviral Particle
RC213865L3V

USD 2,120.00

13 Weeks

Lenti ORF particles, ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_018672) Human Tagged ORF Clone
RC213865L4

USD 1,920.00

10 Weeks

Lenti-ORF clone of ABCA5 (mGFP-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_018672) Human Tagged ORF Clone Lentiviral Particle
RC213865L4V

USD 2,120.00

13 Weeks

Lenti ORF particles, ABCA5 (mGFP-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_172232) Human Tagged ORF Clone
RC220098

USD 1,720.00

7 Weeks

ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCA5 (NM_172232) Human Tagged ORF Clone
RC220098L3

USD 1,920.00

10 Weeks

Lenti-ORF clone of ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_172232) Human Tagged ORF Clone Lentiviral Particle
RC220098L3V

USD 2,120.00

13 Weeks

Lenti ORF particles, ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_172232) Human Tagged ORF Clone
RC220098L4

USD 1,920.00

10 Weeks

Lenti-ORF clone of ABCA5 (mGFP-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_172232) Human Tagged ORF Clone Lentiviral Particle
RC220098L4V

USD 2,120.00

13 Weeks

Lenti ORF particles, ABCA5 (mGFP-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCA5 (NM_018672) Human Tagged ORF Clone
RG213865

USD 1,890.00

7 Weeks

ABCA5 (GFP-tagged) - Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCA5 (NM_172232) Human Tagged ORF Clone
RG220098

USD 1,890.00

7 Weeks

ABCA5 (GFP-tagged) - Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCA5 (NM_172232) Human Untagged Clone
SC306747

USD 3,340.00

In Stock

ABCA5 (untagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ABCA5 Rabbit Polyclonal Antibody
TA331848

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABCA5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCA5 Antibody: synthetic peptide directed towards the C terminal of human ABCA5. Synthetic peptide located within the following region: HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI
ABCA5 (NM_018672) Human Untagged Clone
SC309638

USD 3,340.00

4 Weeks

ABCA5 (untagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1

Vector pCMV6 series
Tag Tag Free
ABCA5 (NM_018672) ICC Control Block
TB413865

USD 2,370.00

4 Weeks

Transient overexpression of ABCA5 (NM_018672) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ABCA5 (NM_172232) ICC Control Block
TB420098

USD 2,370.00

4 Weeks

Transient overexpression of ABCA5 (NM_172232) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ABCA5 ICC Control Sections
TS413865P5

USD 889.00

4 Weeks

Transient overexpression of ABCA5 (NM_018672) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ABCA5 ICC Control Sections
TS420098P5

USD 889.00

4 Weeks

Transient overexpression of ABCA5 (NM_172232) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack