Products

View as table Download

ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ABCA5 (mGFP-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ABCA5 (mGFP-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ABCA5 (mGFP-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ABCA5 (mGFP-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ABCA5 (GFP-tagged) - Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ABCA5 (GFP-tagged) - Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ABCA5 (untagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-ABCA5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCA5 Antibody: synthetic peptide directed towards the C terminal of human ABCA5. Synthetic peptide located within the following region: HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI

ABCA5 (untagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1

Vector pCMV6 series
Tag Tag Free

Transient overexpression of ABCA5 (NM_018672) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ABCA5 (NM_172232) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ABCA5 (NM_018672) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of ABCA5 (NM_172232) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack