Germany
Japan
United Kingdom
China
ABCB8 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table Download
Lenti ORF particles, ABCB8 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ABCB8 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti-ORF clone of ABCB8 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABCB8 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ABCB8 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABCB8 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ABCB8 (myc-DDK-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCB8 (myc-DDK-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCB8 (myc-DDK-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCB8 (GFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of ABCB8 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of ABCB8 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ABCB8 (untagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ABCB8 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), nuclear gene encoding mitochondrial protein
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit anti-ABCB8 polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ABCB8. |
Rabbit Polyclonal Anti-Abcb8 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Abcb8 Antibody is: synthetic peptide directed towards the middle region of Mouse Abcb8. Synthetic peptide located within the following region: ADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSN |
Rabbit Polyclonal Anti-ABCB8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCB8 Antibody: synthetic peptide directed towards the middle region of human ABCB8. Synthetic peptide located within the following region: EPVLFGTTIMENIRFGKLEASDEEVYTAAREANAHEFITSFPEGYNTVVG |
ABCB8 (GFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCB8 (GFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCB8 (GFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCB8 (untagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ABCB8 (untagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ABCB8 (untagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Anti-ABCB8 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 394-693 amino acids of Human ATP-binding cassette sub-family B member 8 |
Anti-ABCB8 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 394-693 amino acids of Human ATP-binding cassette sub-family B member 8 |
Transient overexpression of ABCB8 (NM_007188) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ABCB8 (NM_001282293) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ABCB8 (NM_001282292) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ABCB8 (NM_001282291) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), nuclear gene encoding mitochondrial protein, Leu5-Leu124, with N-terminal His-ABP tag, expressed in E.coli, 50ug
| Tag | N-His ABP |
| Expression Host | E. coli |
Transient overexpression of ABCB8 (NM_007188) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ABCB8 (NM_007188) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ABCB8 (NM_001282293) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ABCB8 (NM_001282292) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ABCB8 (NM_001282291) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ABCB8
Pathways
- ABC transporters