Germany
Japan
United Kingdom
China
UBE2Z (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
UBE2Z (GFP-tagged) - Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human ubiquitin-conjugating enzyme E2Z (UBE2Z), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, UBE2Z (Myc-DDK tagged) - Human ubiquitin-conjugating enzyme E2Z (UBE2Z), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ubiquitin-conjugating enzyme E2Z (UBE2Z), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, UBE2Z (mGFP-tagged) - Human ubiquitin-conjugating enzyme E2Z (UBE2Z), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
UBE2Z (untagged)-Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of ubiquitin-conjugating enzyme E2Z (UBE2Z)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-UBE2Z Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ube2z antibody is: synthetic peptide directed towards the C-terminal region of Rat Ube2z. Synthetic peptide located within the following region: ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCD |
UBE2Z (1-246, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
UBE2Z (1-246, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
UBE2Z HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
UBE2Z (untagged)-Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of UBE2Z (NM_023079) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
| Tag | N-His |
| Expression Host | E. coli |
Purified recombinant protein of Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
| Tag | N-His |
| Expression Host | E. coli |
Purified recombinant protein of Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
| Tag | N-His |
| Expression Host | E. coli |
Purified recombinant protein of Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression of UBE2Z (NM_023079) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of UBE2Z (NM_023079) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- UBE2Z
Pathways
- Acute myeloid leukemia