UBE2Z (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
UBE2Z (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
UBE2Z (GFP-tagged) - Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ubiquitin-conjugating enzyme E2Z (UBE2Z), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UBE2Z (Myc-DDK tagged) - Human ubiquitin-conjugating enzyme E2Z (UBE2Z), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ubiquitin-conjugating enzyme E2Z (UBE2Z), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UBE2Z (mGFP-tagged) - Human ubiquitin-conjugating enzyme E2Z (UBE2Z), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
UBE2Z (untagged)-Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of ubiquitin-conjugating enzyme E2Z (UBE2Z)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-UBE2Z Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ube2z antibody is: synthetic peptide directed towards the C-terminal region of Rat Ube2z. Synthetic peptide located within the following region: ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCD |
UBE2Z (1-246, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
UBE2Z (1-246, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
UBE2Z HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
UBE2Z (untagged)-Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
UBE2Z Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of UBE2Z (NM_023079) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
Tag | N-His |
Expression Host | E. coli |
Purified recombinant protein of Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
Tag | N-His |
Expression Host | E. coli |
Purified recombinant protein of Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
Tag | N-His |
Expression Host | E. coli |
Purified recombinant protein of Human ubiquitin-conjugating enzyme E2Z (UBE2Z)
Tag | N-His |
Expression Host | E. coli |
Transient overexpression of UBE2Z (NM_023079) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of UBE2Z (NM_023079) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack