UBE2Z Rabbit Polyclonal Antibody

CAT#: TA343264

Rabbit Polyclonal Anti-UBE2Z Antibody

Product Images

Host: Rabbit; Target Name: Ube2z; Sample Tissue: Rat Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ube2z antibody is: synthetic peptide directed towards the C-terminal region of Rat Ube2z. Synthetic peptide located within the following region: ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: ubiquitin conjugating enzyme E2 Z
• Database Link:
  NP_075567
  Entrez Gene 303478 Rat
  UniProt ID Q9H832
• Background: Ube2z catalyzes the covalent attachment of ubiquitin to other proteins. It is a specific substrate for UBA6, not charged with ubiquitin by UBE1 and may be involved in apoptosis regulation.
• Synonyms: HOYS7; USE1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Acute myeloid leukemia, Pathways in cancer, Ubiquitin mediated proteolysis