PTPRM (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PTPRM (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PTPRM (GFP-tagged) - Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PTPRM (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PTPRM (GFP-tagged) - Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PTPRM (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,920.00
6 Weeks
Lenti ORF particles, PTPRM (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PTPRM (mGFP-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,920.00
6 Weeks
Lenti ORF particles, PTPRM (mGFP-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PTPRM (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,940.00
6 Weeks
Lenti ORF particles, PTPRM (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PTPRM (mGFP-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,940.00
6 Weeks
Lenti ORF particles, PTPRM (mGFP-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PTPRM (untagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PTPRM (untagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PTPRM HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PTPRM Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Hamster, Horse, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | PTPRM / PTP Mu antibody was raised against synthetic 18 amino acid peptide from internal region of human PTPRM. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Hamster, Panda, Horse, Rabbit, Opossum (100%); Marmoset, Bovine, Bat (94%). |
Rabbit Polyclonal Anti-PTPRM Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | PTPRM / PTP Mu antibody was raised against synthetic 16 amino acid peptide from internal region of human PTPRM. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Bovine, Bat, Horse, Rabbit (100%); Opossum, Chicken (94%); Elephant, Panda, Dog (88%); Gorilla, Xenopus (81%). |
Rabbit Polyclonal Anti-PTPRM Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | PTPRM / PTP Mu antibody was raised against synthetic 15 amino acid peptide from internal region of human PTPRM. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Hamster, Panda, Dog, Bat, Horse, Rabbit, Opossum (100%); Mouse, Elephant, Bovine, Xenopus (93%); Chicken (87%). |
Rabbit Polyclonal Anti-PTPRM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTPRM antibody is: synthetic peptide directed towards the middle region of Human PTPRM. Synthetic peptide located within the following region: QQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLNGG |
Anti-PTPRM Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1370-1385 amino acids of Human protein tyrosine phosphatase, receptor type, M |
Anti-PTPRM Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1370-1385 amino acids of Human protein tyrosine phosphatase, receptor type, M |
Transient overexpression of PTPRM (NM_002845) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PTPRM (NM_001105244) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PTPRM (NM_002845) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PTPRM (NM_001105244) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PTPRM (NM_001105244) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack