Germany
Japan
United Kingdom
China
SSX2IP (Myc-DDK-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, SSX2IP (Myc-DDK tagged) - Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SSX2IP (mGFP-tagged) - Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
SSX2IP (GFP-tagged) - Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 5, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SSX2IP (Myc-DDK tagged) - Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 5, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SSX2IP (mGFP-tagged) - Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SSX2IP (Myc-DDK-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of SSX2IP (Myc-DDK-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 4
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SSX2IP (Myc-DDK-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of SSX2IP (mGFP-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 4
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SSX2IP (mGFP-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SSX2IP (Myc-DDK-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of SSX2IP (Myc-DDK-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SSX2IP (Myc-DDK-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of SSX2IP (mGFP-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SSX2IP (mGFP-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SSX2IP (Myc-DDK-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of SSX2IP (Myc-DDK-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SSX2IP (Myc-DDK-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of SSX2IP (mGFP-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SSX2IP (mGFP-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SSX2IP (Myc-DDK-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of SSX2IP (Myc-DDK-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SSX2IP (Myc-DDK-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of SSX2IP (mGFP-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SSX2IP (mGFP-tagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SSX2IP (GFP-tagged) - Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SSX2IP (GFP-tagged) - Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SSX2IP (GFP-tagged) - Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SSX2IP (GFP-tagged) - Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 5, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 5, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 5, full length, with N-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
SSX2IP HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 5
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-SSX2IP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SSX2IP Antibody: synthetic peptide directed towards the middle region of human SSX2IP. Synthetic peptide located within the following region: KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA |
Carrier-free (BSA/glycerol-free) SSX2IP mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SSX2IP mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SSX2IP (untagged)-Human synovial sarcoma, X breakpoint 2 interacting protein (SSX2IP), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SC310217 is the updated version of SC127345.
SSX2IP (untagged)-Human synovial sarcoma X breakpoint 2 interacting protein (SSX2IP) transcript variant 4
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SSX2IP (untagged)-Human synovial sarcoma X breakpoint 2 interacting protein (SSX2IP) transcript variant 3
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SSX2IP (untagged)-Human synovial sarcoma X breakpoint 2 interacting protein (SSX2IP) transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SSX2IP (untagged)-Human synovial sarcoma X breakpoint 2 interacting protein (SSX2IP) transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-SSX2IP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SSX2IP |
SSX2IP mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SSX2IP mouse monoclonal antibody, clone OTI1B6 (formerly 1B6), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Active filters
Target Symbol
- SSX2IP
Pathways
- Adherens junction