UGP2 (Myc-DDK-tagged)-Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
UGP2 (Myc-DDK-tagged)-Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
UGP2 (Myc-DDK-tagged)-Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, UGP2 (Myc-DDK tagged) - Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, UGP2 (mGFP-tagged) - Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
UGP2 (GFP-tagged) - Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
UGP2 (GFP-tagged) - Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UGP2 (Myc-DDK tagged) - Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UGP2 (mGFP-tagged) - Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UGP2 (Myc-DDK tagged) - Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UGP2 (mGFP-tagged) - Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-UGP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGP2 antibody: synthetic peptide directed towards the N terminal of human UGP2. Synthetic peptide located within the following region: TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN |
Lenti ORF clone of Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
UGP2 (untagged)-Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
UGP2 (1-508, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
UGP2 (1-508, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
UGP2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
UGP2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
UGP2 MS Standard C13 and N15-labeled recombinant protein (NP_001001521)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
UGP2 MS Standard C13 and N15-labeled recombinant protein (NP_006750)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
UGP2 (untagged)-Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-UGP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UGP2 |
Transient overexpression of UGP2 (NM_001001521) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UGP2 (NM_006759) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UGP2 (NM_001001521) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of UGP2 (NM_001001521) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of UGP2 (NM_006759) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of UGP2 (NM_006759) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack