Products

cDNA Clones (7)
Proteins (3)
Antibodies (1)
Jump to Filters
View as table Download
UGT1A7 (NM_019077) Human Tagged ORF Clone
RC216210

USD 480.00

In Stock

UGT1A7 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT1A7 (NM_019077) Human Tagged ORF Clone
RC216210L3

USD 680.00

3 Weeks

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT1A7 (NM_019077) Human Tagged ORF Clone Lentiviral Particle
RC216210L3V

USD 880.00

6 Weeks

Lenti ORF particles, UGT1A7 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT1A7 (NM_019077) Human Tagged ORF Clone
RC216210L4

USD 680.00

3 Weeks

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT1A7 (NM_019077) Human Tagged ORF Clone Lentiviral Particle
RC216210L4V

USD 880.00

6 Weeks

Lenti ORF particles, UGT1A7 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT1A7 (NM_019077) Human Tagged ORF Clone
RG216210

USD 530.00

3 Weeks

UGT1A7 (GFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT1A7 (NM_019077) Human Untagged Clone
SC304666

USD 900.00

In Stock

UGT1A7 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
UGT1A7 Rabbit Polyclonal Antibody
TA331082

USD 375.00

5 Days

Rabbit polyclonal Anti-UGT1A7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7. Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN
UGT1A7 (NM_019077) ICC Control Block
TB416210

USD 1,130.00

4 Weeks

Transient overexpression of UGT1A7 (NM_019077) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UGT1A7 Cytosection
TS416210

USD 225.00

4 Weeks

Transient overexpression of UGT1A7 (NM_019077) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

UGT1A7 Cytosection
TS416210P5

USD 889.00

4 Weeks

Transient overexpression of UGT1A7 (NM_019077) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack