USD 98.00
USD 560.00
In Stock
ALDH3A2 (Myc-DDK-tagged)-Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 98.00
USD 560.00
In Stock
ALDH3A2 (Myc-DDK-tagged)-Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ALDH3A2 (Myc-DDK-tagged)-Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 867.00
In Stock
Recombinant protein of human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 820.00
3 Weeks
Lenti ORF particles, ALDH3A2 (Myc-DDK tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, ALDH3A2 (mGFP-tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 850.00
3 Weeks
Lenti ORF particles, ALDH3A2 (Myc-DDK tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 850.00
6 Weeks
Lenti ORF particles, ALDH3A2 (mGFP-tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 460.00
In Stock
ALDH3A2 (GFP-tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
5 Weeks
Lenti ORF particles, ALDH3A2 (Myc-DDK tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 620.00
In Stock
Lenti ORF clone of Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, ALDH3A2 (mGFP-tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 650.00
In Stock
Lenti ORF clone of Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 850.00
3 Weeks
Lenti ORF particles, ALDH3A2 (Myc-DDK tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 650.00
3 Weeks
Lenti ORF clone of Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 850.00
7 Weeks
Lenti ORF particles, ALDH3A2 (mGFP-tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ALDH3A2 (GFP-tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal FALDH Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
USD 620.00
In Stock
Lenti ORF clone of Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
ALDH3A2 (untagged)-Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Goat Polyclonal Anti-ALDH3A2 Antibody
Applications | IHC |
Reactivities | Human (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1. |
USD 121.00
In Stock
ALDH3A2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 620.00
3 Weeks
Lenti ORF clone of Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 650.00
3 Weeks
Lenti ORF clone of Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 760.00
In Stock
ALDH3A2 (untagged)-Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
USD 121.00
In Stock
ALDH3A2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 187.00
In Stock
ALDH3A2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 396.00
In Stock
Transient overexpression lysate of aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
USD 605.00
In Stock
Transient overexpression lysate of aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
USD 396.00
In Stock
Transient overexpression lysate of aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Aldh3A2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Aldh3A2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Aldh3A2. |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the middle region of human ALDH3A2. Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI 1B11 (formerly 1B11)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | FC, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
Applications | WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
USD 2,055.00
3 Weeks
ALDH3A2 MS Standard C13 and N15-labeled recombinant protein (NP_001026976)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
USD 2,055.00
3 Weeks
ALDH3A2 MS Standard C13 and N15-labeled recombinant protein (NP_000373)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ALDH3A2 |
USD 379.00
In Stock
ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | HRP |
USD 159.00
2 Days
ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
ALDH3A2 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1), Biotinylated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1), HRP conjugated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | HRP |
USD 159.00
2 Days
ALDH3A2 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
ALDH3A2 mouse monoclonal antibody, clone OTI 1B11 (formerly 1B11)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".