Germany
Japan
United Kingdom
China
ABP1 (Myc-DDK-tagged)-Human amiloride binding protein 1 (amine oxidase (copper-containing)) (ABP1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human amiloride binding protein 1 (amine oxidase (copper-containing)) (ABP1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Lenti ORF particles, AOC1 (Myc-DDK tagged) - Human amiloride binding protein 1 (amine oxidase (copper-containing)) (ABP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, AOC1 (mGFP-tagged) - Human amiloride binding protein 1 (amine oxidase (copper-containing)) (ABP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ABP1 (GFP-tagged) - Human amiloride binding protein 1 (amine oxidase (copper-containing)) (ABP1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human amiloride binding protein 1 (amine oxidase (copper-containing)) (ABP1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AOC1 (Myc-DDK tagged) - Human amiloride binding protein 1 (amine oxidase (copper-containing)) (ABP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human amiloride binding protein 1 (amine oxidase (copper-containing)) (ABP1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AOC1 (mGFP-tagged) - Human amiloride binding protein 1 (amine oxidase (copper-containing)) (ABP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ABP1 (Myc-DDK tagged) - Homo sapiens amine oxidase, copper containing 1 (AOC1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABP1 (GFP-tagged) - Homo sapiens amine oxidase, copper containing 1 (AOC1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human amiloride binding protein 1 (amine oxidase (copper-containing)) (ABP1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-ABP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABP1 antibody: synthetic peptide directed towards the C terminal of human ABP1. Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF |
Rabbit polyclonal antibody to KAO (amiloride binding protein 1 (amine oxidase (copper-containing)))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 179 of KAO (Uniprot ID#P19801) |
ABP1 (untagged)-Human amiloride binding protein 1 (amine oxidase (copper-containing)) (ABP1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human amiloride binding protein 1 (amine oxidase (copper-containing)) (ABP1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ABP1 (AOC1) rabbit polyclonal antibody, Serum
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Recombinant Human Diamine Oxidase (DAO). |
ABP1 (AOC1) rabbit polyclonal antibody, Serum
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Recombinant Human Diamine Oxidase (DAO). |
ABP1 (AOC1) goat polyclonal antibody, Serum
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Recombinant Human Diamine Oxidase (DAO). |
ABP1 (AOC1) goat polyclonal antibody, Serum
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Recombinant Human Diamine Oxidase (DAO). |
AOC1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of amiloride binding protein 1 (amine oxidase (copper-containing)) (ABP1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
ABP1 MS Standard C13 and N15-labeled recombinant protein (NP_001082)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
ABP1 (untagged) - Homo sapiens amine oxidase, copper containing 1 (AOC1), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of AOC1 (NM_001091) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AOC1 (NM_001272072) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AOC1 (NM_001091) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AOC1 (NM_001091) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of AOC1 (NM_001272072) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- AOC1
Pathways
- Arginine and proline metabolism