Germany
Japan
United Kingdom
China
PRODH2 (Myc-DDK-tagged)-Human proline dehydrogenase (oxidase) 2 (PRODH2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, PRODH2 (mGFP-tagged) - Human proline dehydrogenase (oxidase) 2 (PRODH2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, PRODH2 (Myc-DDK tagged) - Human proline dehydrogenase (oxidase) 2 (PRODH2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
PRODH2 (GFP-tagged) - Human proline dehydrogenase (oxidase) 2 (PRODH2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human proline dehydrogenase (oxidase) 2 (PRODH2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PRODH2 (Myc-DDK tagged) - Human proline dehydrogenase (oxidase) 2 (PRODH2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human proline dehydrogenase (oxidase) 2 (PRODH2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PRODH2 (mGFP-tagged) - Human proline dehydrogenase (oxidase) 2 (PRODH2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human proline dehydrogenase (oxidase) 2 (PRODH2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human proline dehydrogenase (oxidase) 2 (PRODH2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-PRODH2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRODH2 antibody: synthetic peptide directed towards the C terminal of human PRODH2. Synthetic peptide located within the following region: LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIR |
Transient overexpression lysate of proline dehydrogenase (oxidase) 2 (PRODH2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PRODH2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 171-200 amino acids from the Central region of human PRODH2 |
PRODH2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PRODH2 (untagged)-Human proline dehydrogenase (oxidase) 2 (PRODH2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression of PRODH2 (NM_021232) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PRODH2 (NM_021232) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PRODH2 (NM_021232) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PRODH2
Pathways
- Arginine and proline metabolism