Products

cDNA Clones (11)
Proteins (6)
Antibodies (3)
Jump to Filters
View as table Download
UGT (UGT1A9) (NM_021027) Human Tagged ORF Clone
RC208861

USD 480.00

In Stock

UGT1A9 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
UGT (UGT1A9) (NM_021027) Human Tagged ORF Clone Lentiviral Particle
RC208861L2V

USD 880.00

6 Weeks

Lenti ORF particles, UGT1A9 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
UGT (UGT1A9) (NM_021027) Human Tagged ORF Clone
RG208861

USD 530.00

In Stock

UGT1A9 (GFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT (UGT1A9) (NM_021027) Human Tagged ORF Clone
RC208861L3

USD 680.00

3 Weeks

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT (UGT1A9) (NM_021027) Human Tagged ORF Clone Lentiviral Particle
RC208861L3V

USD 880.00

5 Weeks

Lenti ORF particles, UGT1A9 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT (UGT1A9) (NM_021027) Human Tagged ORF Clone
RC208861L4

USD 680.00

3 Weeks

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT (UGT1A9) (NM_021027) Human Tagged ORF Clone Lentiviral Particle
RC208861L4V

USD 880.00

7 Weeks

Lenti ORF particles, UGT1A9 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT (UGT1A9) (NM_021027) Human Untagged Clone
SC113006

USD 310.00

In Stock

UGT1A9 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
UGT (UGT1A9) (NM_021027) Human Tagged ORF Clone
RC208861L1

USD 840.00

In Stock

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
UGT (UGT1A9) Rabbit Polyclonal Antibody
TA308133

USD 415.00

In Stock

Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656)
UGT (UGT1A9) Rabbit Polyclonal Antibody
TA327128

USD 275.00

3 Weeks

UGT1A9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A9
UGT (UGT1A9) (NM_021027) Human Over-expression Lysate
LY412150

USD 396.00

5 Days

Transient overexpression lysate of UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
UGT (UGT1A9) (NM_021027) Human Tagged ORF Clone
RC208861L2

USD 680.00

3 Weeks

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
UGT (UGT1A9) (NM_021027) Human Over-expression Lysate
LC412150

USD 121.00

In Stock

UGT1A9 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
UGT (UGT1A9) (NM_021027) Human Recombinant Protein
TP761285

USD 215.00

In Stock

Purified recombinant protein of Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
UGT (UGT1A9) Rabbit Polyclonal Antibody
TA329453

USD 375.00

5 Days

Rabbit Polyclonal anti-UGT1A9 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A9 antibody: synthetic peptide directed towards the N terminal of human UGT1A9. Synthetic peptide located within the following region: LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV
UGT (UGT1A9) (NM_021027) ICC Control Block
TB408861

USD 1,130.00

4 Weeks

Transient overexpression of UGT1A9 (NM_021027) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UGT (UGT1A9) Cytosection
TS408861

USD 225.00

4 Weeks

Transient overexpression of UGT1A9 (NM_021027) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

UGT (UGT1A9) Cytosection
TS408861P5

USD 889.00

4 Weeks

Transient overexpression of UGT1A9 (NM_021027) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack