Germany
Japan
United Kingdom
China
IL5 (Myc-DDK-tagged)-Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
IL5 (GFP-tagged) - Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL5 (Myc-DDK tagged) - Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL5 (mGFP-tagged) - Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5).
| Tag | Tag Free |
| Expression Host | E. coli |
IL5 (untagged)-Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-Interleukin 5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5 |
Rabbit Polyclonal Anti-IL5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL5 Antibody: synthetic peptide directed towards the middle region of human IL5. Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Human, Rhesus Macaque |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Rhesus Macaque, Cynomolgus Monkey, Human |
| Conjugation | Unconjugated |
Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
| Tag | C-His |
| Expression Host | HEK293 |
IL5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression of IL5 (NM_000879) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug
| Tag | C-HIS |
| Expression Host | HEK293 |
Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
| Tag | C-His |
| Expression Host | HEK293 |
Transient overexpression of IL5 (NM_000879) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IL5 (NM_000879) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- IL5
Pathways
- Autoimmune thyroid disease