Products

View as table Download

USD 98.00

USD 390.00

In Stock

IL5 (Myc-DDK-tagged)-Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Il5 (Myc-DDK-tagged) - Mouse interleukin 5 (Il5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

IL5 (GFP-tagged) - Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

IL5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN409681 is the updated version of KN209681.

Il5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN508291 is the updated version of KN308291.

Il5 (GFP-tagged) - Mouse interleukin 5 (Il5), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Il5 (Myc-DDK-tagged) - Mouse interleukin 5 (Il5)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Il5 (mGFP-tagged) - Mouse interleukin 5 (Il5)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, IL5 (Myc-DDK tagged) - Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, IL5 (mGFP-tagged) - Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Il5 (Myc-DDK-tagged ORF) - Rat interleukin 5 (Il5), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Il5 (Myc-DDK-tagged ORF) - Rat interleukin 5 (Il5), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Il5 (mGFP-tagged ORF) - Rat interleukin 5 (Il5), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Il5 (GFP-tagged ORF) - Rat interleukin 5 (Il5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5).

Tag Tag Free
Expression Host E. coli

Il5 (untagged) - Mouse interleukin 5 (Il5), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

IL5 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 61-110 of Human IL-5

qSTAR qPCR primer pairs against Homo sapiens gene IL5

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

IL5 (untagged)-Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Anti-Human IL-5 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-5

Purified recombinant protein of Mouse interleukin 5 (Il5).

Tag Tag Free
Expression Host E. coli

Purified recombinant protein of Rat interleukin 5 (Il5).

Tag Tag Free
Expression Host E. coli

Purified recombinant protein of Mouse interleukin 5 (Il5)

Tag Tag Free
Expression Host Sf9

Rabbit Polyclonal Anti-Interleukin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5

Il5 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Mouse
Conjugation Biotin
Immunogen Highly pure recombinant Murine IL-5

Il5 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Mouse
Conjugation Biotin
Immunogen Highly pure recombinant Murine IL-5

Il5 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Mouse
Immunogen Highly pure recombinant Murine IL-5

Il5 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Mouse
Immunogen Highly pure recombinant Murine IL-5

qSTAR qPCR primer pairs against Mus musculus gene Il5

Anti-Murine IL-5 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine IL-5

Biotinylated Anti-Human IL-5 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-5

Biotinylated Anti-Murine IL-5 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Murine
Conjugation Unconjugated
Immunogen Recombinant Murine IL-5

Rabbit Polyclonal Anti-Il5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Il5 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL

Rabbit Polyclonal Anti-IL5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL5 Antibody: synthetic peptide directed towards the middle region of human IL5. Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL

Mouse Monoclonal Anti-IL-5 Antibody

Reactivities Human, Rhesus Macaque
Conjugation Unconjugated

Mouse Monoclonal Anti-IL-5 Antibody

Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-IL-5 Antibody

Reactivities Rhesus Macaque, Cynomolgus Monkey, Human
Conjugation Unconjugated

Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)

Tag C-His
Expression Host HEK293

Human IL-5 ELISA Kit (48-well)

Assay Type Solid Phase Sandwich ELISA
Format 48-well strip plate
Reactivities Human

Human IL-5 ELISA Kit (96-well)

Assay Type Solid Phase Sandwich ELISA
Format 96-well strip plate
Reactivities Human

Mouse IL-5 ELISA Kit (48-well)

Assay Type Solid Phase Sandwich ELISA
Format 48-well strip plate
Reactivities Mouse

Mouse IL-5 ELISA Kit (96-well)

Assay Type Solid Phase Sandwich ELISA
Format 96-well strip plate
Reactivities Mouse

USD 415.00

3 Weeks

Human IL-5 ELISA Kit

Assay Type Sandwich ELISA kit of Quantitative Detection for Human IL-5
Reactivities Human

USD 415.00

3 Weeks

Mouse IL-5 ELISA Kit

Assay Type Sandwich ELISA kit of Quantitative Detection for Mouse IL-5
Reactivities Mouse

Human IL-5 ELISA Kit, 1 x 48-well (pre-coated)

Assay Type Solid Phase Sandwich ELISA
Format 1 x 48-well (pre-coated)