Germany
Japan
United Kingdom
China
IL5 (Myc-DDK-tagged)-Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Il5 (Myc-DDK-tagged) - Mouse interleukin 5 (Il5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL5 (GFP-tagged) - Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN409681 is the updated version of KN209681.
Il5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508291 is the updated version of KN308291.
Il5 (GFP-tagged) - Mouse interleukin 5 (Il5), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Il5 (Myc-DDK-tagged) - Mouse interleukin 5 (Il5)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Il5 (Myc-DDK-tagged) - Mouse interleukin 5 (Il5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Il5 (mGFP-tagged) - Mouse interleukin 5 (Il5)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Il5 (GFP-tagged) - Mouse interleukin 5 (Il5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL5 (Myc-DDK tagged) - Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL5 (mGFP-tagged) - Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Il5 (Myc-DDK-tagged ORF) - Rat interleukin 5 (Il5), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Il5 (Myc-DDK-tagged ORF) - Rat interleukin 5 (Il5), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Il5 (Myc-DDK-tagged ORF) - Rat interleukin 5 (Il5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Il5 (mGFP-tagged ORF) - Rat interleukin 5 (Il5), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Il5 (GFP-tagged ORF) - Rat interleukin 5 (Il5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5).
| Tag | Tag Free |
| Expression Host | E. coli |
Il5 (untagged) - Mouse interleukin 5 (Il5), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Homo sapiens gene IL5
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
IL5 (untagged)-Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Purified recombinant protein of Mouse interleukin 5 (Il5).
| Tag | Tag Free |
| Expression Host | E. coli |
Purified recombinant protein of Rat interleukin 5 (Il5).
| Tag | Tag Free |
| Expression Host | E. coli |
Purified recombinant protein of Mouse interleukin 5 (Il5)
| Tag | Tag Free |
| Expression Host | Sf9 |
Rabbit Polyclonal Anti-Interleukin 5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5 |
Il5 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Biotin |
| Immunogen | Highly pure recombinant Murine IL-5 |
Il5 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Biotin |
| Immunogen | Highly pure recombinant Murine IL-5 |
Il5 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Immunogen | Highly pure recombinant Murine IL-5 |
Il5 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Immunogen | Highly pure recombinant Murine IL-5 |
qSTAR qPCR primer pairs against Mus musculus gene Il5
Rabbit Polyclonal Anti-Il5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Il5 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL |
Rabbit Polyclonal Anti-IL5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL5 Antibody: synthetic peptide directed towards the middle region of human IL5. Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Human, Rhesus Macaque |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Rhesus Macaque, Cynomolgus Monkey, Human |
| Conjugation | Unconjugated |
Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)
| Tag | C-His |
| Expression Host | HEK293 |
Human IL-5 ELISA Kit (48-well)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 48-well strip plate |
| Reactivities | Human |
Human IL-5 ELISA Kit (96-well)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 96-well strip plate |
| Reactivities | Human |
Mouse IL-5 ELISA Kit (48-well)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 48-well strip plate |
| Reactivities | Mouse |
Mouse IL-5 ELISA Kit (96-well)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 96-well strip plate |
| Reactivities | Mouse |
Human IL-5 ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human IL-5 |
| Reactivities | Human |
Mouse IL-5 ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Mouse IL-5 |
| Reactivities | Mouse |
Human IL-5 ELISA Kit, 1 x 48-well (pre-coated)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 1 x 48-well (pre-coated) |
Active filters
Target Symbol
- IL5