Il5 (NM_010558) Mouse Recombinant Protein

CAT#: TP723238

Purified recombinant protein of Mouse interleukin 5 (Il5).


  View other "Il5" proteins (2)

USD 240.00

5 Days*

Size
    • 25 ug

Product Images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
Tag Tag Free
Predicted MW 26.2 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is > 2.0 ng/ml, corresponding to a specific activity of > 5 x 10^5units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_034688
Locus ID 16191
UniProt ID P04401, Q5SV01
Cytogenetics 11 31.99 cM
Refseq Size 1534
Refseq ORF 402
Synonyms Il-5
Summary Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells. [UniProtKB/Swiss-Prot Function]

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.