Il5 (NM_010558) Mouse Recombinant Protein

CAT#: TP723238

Purified recombinant protein of Mouse interleukin 5 (Il5).

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
• Tag: Tag Free
• Predicted MW: 26.2 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is > 2.0 ng/ml, corresponding to a specific activity of > 5 x 10^5units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_034688
• Locus ID: 16191
• UniProt ID: P04401, Q5SV01
• Cytogenetics: 11 31.99 cM
• Refseq Size: 1534
• Refseq ORF: 402
• Synonyms: Il-5
• Summary: Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells. [UniProtKB/Swiss-Prot Function]