Il5 (NM_021834) Rat Recombinant Protein

CAT#: TP723239

Purified recombinant protein of Rat interleukin 5 (Il5).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV
• Tag: Tag Free
• Predicted MW: 26 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is > 0.5 ng/ml, corresponding to a specific activity of > 2 x 10^6 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068606
• Locus ID: 24497
• UniProt ID: Q9R2C9
• Cytogenetics: 10q22
• Refseq Size: 399
• Refseq ORF: 396
• Summary: cytokine with B-cell growth factor activity [RGD, Feb 2006]