Germany
Japan
United Kingdom
China
EFNB3 (Myc-DDK-tagged)-Human ephrin-B3 (EFNB3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF clone of Human ephrin-B3 (EFNB3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, EFNB3 (Myc-DDK tagged) - Human ephrin-B3 (EFNB3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ephrin-B3 (EFNB3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, EFNB3 (mGFP-tagged) - Human ephrin-B3 (EFNB3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
EFNB3 (GFP-tagged) - Human ephrin-B3 (EFNB3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
EFNB3 (untagged)-Human ephrin-B3 (EFNB3)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-EFNB3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Efnb3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Efnb3. Synthetic peptide located within the following region: AGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGE |
Rabbit anti Ephrin B3 Polyclonal Antibody
| Reactivities | Human |
| Immunogen | Recombinant protein encoding aa 135-341 of human Ephrin B3 expressed in E.Coli. |
Ephrin-B3 (28-226, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Ephrin-B3 (28-226, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-EFNB3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human EFNB3 |
EFNB3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of EFNB3 (NM_001406) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of EFNB3 (NM_001406) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of EFNB3 (NM_001406) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- EFNB3
Pathways
- Axon guidance