Products

View as table Download

EPHB3 (GFP-tagged) - Human EPH receptor B3 (EPHB3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

EPHB3 (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens EPH receptor B3, Signal peptide (1-33) plus EC domain (34-559)

Vector pCMV6-XL5-DDK-His
Tag DDK-His
Mammalian Cell Selection None
  • TrueORF®

EPHB3 (untagged)-Human EPH receptor B3 (EPHB3)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression lysate of EPH receptor B3 (EPHB3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Purified recombinant protein of human EPH receptor B3 (EPHB3), with C-terminal DDK/His tag, expressed in human cells, 20 µg

Tag C-DDK/His
Expression Host HEK293

EPHB3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Purified recombinant protein of Human EPH receptor B3 (EPHB3), residues 34-559aa, with C-terminal DDK tag, expressed in sf9, 20ug

Tag C-DDK
Expression Host Sf9

Rabbit Polyclonal Anti-EPHB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPHB3 antibody is: synthetic peptide directed towards the C-terminal region of Human EPHB3. Synthetic peptide located within the following region: QLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQYI

EPHB3 MS Standard C13 and N15-labeled recombinant protein (NP_004434)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-EPHB3 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EPHB3

Transient overexpression of EPHB3 (NM_004443) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of EPHB3 (NM_004443) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of EPHB3 (NM_004443) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack