Germany
Japan
United Kingdom
China
RHOD (Myc-DDK-tagged)-Human ras homolog gene family, member D (RHOD)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human ras homolog gene family, member D (RHOD)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
RHOD (GFP-tagged) - Human ras homolog gene family, member D (RHOD)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human ras homolog gene family, member D (RHOD), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RHOD (Myc-DDK tagged) - Human ras homolog gene family, member D (RHOD), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ras homolog gene family, member D (RHOD), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RHOD (mGFP-tagged) - Human ras homolog gene family, member D (RHOD), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
RHOD (myc-DDK-tagged) - Human ras homolog family member D (RHOD), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit polyclonal anti-RHOD antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RHOD. |
RHOD HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-RHOD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RHOD antibody: synthetic peptide directed towards the N terminal of human RHOD. Synthetic peptide located within the following region: TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVF |
Rabbit Polyclonal Anti-RHOD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RHOD antibody: synthetic peptide directed towards the C terminal of human RHOD. Synthetic peptide located within the following region: NGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRG |
RHOD (untagged)-Human ras homolog gene family, member D (RHOD)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
RhoD (18-207, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
RhoD (18-207, His-tag) human recombinant protein, 10 µg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression lysate of ras homolog gene family, member D (RHOD)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RHOD MS Standard C13 and N15-labeled recombinant protein (NP_055393)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
RHOD (GFP-tagged) - Human ras homolog family member D (RHOD), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RHOD (untagged) - Human ras homolog family member D (RHOD), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of RHOD (NM_014578) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RHOD (NM_001300886) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RHOD (NM_014578) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RHOD (NM_014578) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RHOD (NM_001300886) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- RHOD
Pathways
- Axon guidance