Products

cDNA Clones (15)
Proteins (8)
Antibodies (2)
Jump to Filters
View as table Download
SRGAP3 (NM_014850) Human Tagged ORF Clone
RC214288

USD 1,150.00

In Stock

SRGAP3 (Myc-DDK-tagged)-Human SLIT-ROBO Rho GTPase activating protein 3 (SRGAP3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SRGAP3 (NM_014850) Human Tagged ORF Clone
RC214288L3

USD 1,350.00

3 Weeks

Lenti ORF clone of Human SLIT-ROBO Rho GTPase activating protein 3 (SRGAP3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SRGAP3 (NM_014850) Human Tagged ORF Clone Lentiviral Particle
RC214288L3V

USD 1,550.00

6 Weeks

Lenti ORF particles, SRGAP3 (Myc-DDK tagged) - Human SLIT-ROBO Rho GTPase activating protein 3 (SRGAP3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SRGAP3 (NM_014850) Human Tagged ORF Clone
RC214288L4

USD 1,350.00

3 Weeks

Lenti ORF clone of Human SLIT-ROBO Rho GTPase activating protein 3 (SRGAP3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SRGAP3 (NM_014850) Human Tagged ORF Clone Lentiviral Particle
RC214288L4V

USD 1,550.00

6 Weeks

Lenti ORF particles, SRGAP3 (mGFP-tagged) - Human SLIT-ROBO Rho GTPase activating protein 3 (SRGAP3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SRGAP3 (NM_001033117) Human Tagged ORF Clone
RC217925

USD 1,130.00

5 Weeks

SRGAP3 (Myc-DDK-tagged)-Human SLIT-ROBO Rho GTPase activating protein 3 (SRGAP3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SRGAP3 (NM_001033117) Human Tagged ORF Clone
RC217925L3

USD 1,330.00

5 Weeks

Lenti-ORF clone of SRGAP3 (Myc-DDK-tagged)-Human SLIT-ROBO Rho GTPase activating protein 3 (SRGAP3), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SRGAP3 (NM_001033117) Human Tagged ORF Clone Lentiviral Particle
RC217925L3V

USD 1,530.00

8 Weeks

Lenti ORF particles, SRGAP3 (Myc-DDK-tagged)-Human SLIT-ROBO Rho GTPase activating protein 3 (SRGAP3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SRGAP3 (NM_001033117) Human Tagged ORF Clone
RC217925L4

USD 1,330.00

5 Weeks

Lenti-ORF clone of SRGAP3 (mGFP-tagged)-Human SLIT-ROBO Rho GTPase activating protein 3 (SRGAP3), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SRGAP3 (NM_001033117) Human Tagged ORF Clone Lentiviral Particle
RC217925L4V

USD 1,530.00

8 Weeks

Lenti ORF particles, SRGAP3 (mGFP-tagged)-Human SLIT-ROBO Rho GTPase activating protein 3 (SRGAP3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SRGAP3 (NM_014850) Human Tagged ORF Clone
RG214288

USD 1,260.00

3 Weeks

SRGAP3 (GFP-tagged) - Human SLIT-ROBO Rho GTPase activating protein 3 (SRGAP3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SRGAP3 (NM_001033117) Human Tagged ORF Clone
RG217925

USD 1,240.00

6 Weeks

SRGAP3 (GFP-tagged) - Human SLIT-ROBO Rho GTPase activating protein 3 (SRGAP3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SRGAP3 Rabbit Polyclonal Antibody
TA338076

USD 375.00

5 Days

Rabbit Polyclonal Anti-SRGAP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRGAP3 antibody is: synthetic peptide directed towards the N-terminal region of Human SRGAP3. Synthetic peptide located within the following region: SSVKKIEKMKEKRQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDV
SRGAP3 (NM_014850) Human Over-expression Lysate
LC414980

USD 187.00

2 Weeks

SRGAP3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SRGAP3 (NM_014850) Human Over-expression Lysate
LY414980

USD 605.00

5 Days

Transient overexpression lysate of SLIT-ROBO Rho GTPase activating protein 3 (SRGAP3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SRGAP3 (NM_014850) Human Mass Spec Standard
PH314288

USD 2,055.00

3 Weeks

SRGAP3 MS Standard C13 and N15-labeled recombinant protein (NP_055665)

Tag C-Myc/DDK
Expression Host HEK293
SRGAP3 (NM_001033117) Human Untagged Clone
SC302704

USD 2,180.00

6 Weeks

SRGAP3 (untagged)-Human SLIT-ROBO Rho GTPase activating protein 3 (SRGAP3), transcript variant 2

Vector pCMV6 series
Tag Tag Free
SRGAP3 (NM_014850) Human Untagged Clone
SC309984

USD 2,240.00

3 Weeks

SRGAP3 (untagged)-Human SLIT-ROBO Rho GTPase activating protein 3 (SRGAP3), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SC309984 is the updated version of SC100721.
SRGAP3 (AK094355) Human Untagged Clone
SC312848

USD 960.00

3 Weeks

(untagged)-Human cDNA FLJ37036 fis, clone BRACE2011592, moderately similar to RHO-GTPASE-ACTIVATING PROTEIN 4

Vector pCMV6 series
Tag Tag Free
SRGAP3 Rabbit Polyclonal Antibody
TA350444

USD 345.00

In Stock

Rabbit Polyclonal Anti-SRGAP3 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SRGAP3
SRGAP3 (NM_014850) ICC Control Block
TB414288

USD 1,800.00

4 Weeks

Transient overexpression of SRGAP3 (NM_014850) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SRGAP3 (NM_001033117) ICC Control Block
TB417925

USD 1,780.00

4 Weeks

Transient overexpression of SRGAP3 (NM_001033117) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SRGAP3 Cytosection
TS414288

USD 225.00

4 Weeks

Transient overexpression of SRGAP3 (NM_014850) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SRGAP3 Cytosection
TS414288P5

USD 889.00

4 Weeks

Transient overexpression of SRGAP3 (NM_014850) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SRGAP3 ICC Control Sections
TS417925P5

USD 889.00

4 Weeks

Transient overexpression of SRGAP3 (NM_001033117) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack