Germany
Japan
United Kingdom
China
PTCH2 (Myc-DDK-tagged)-Human patched 2 (PTCH2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF clone of Human patched 2 (PTCH2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PTCH2 (Myc-DDK tagged) - Human patched 2 (PTCH2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human patched 2 (PTCH2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PTCH2 (mGFP-tagged) - Human patched 2 (PTCH2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PTCH2 (Myc-DDK-tagged)-Human patched 2 (PTCH2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of PTCH2 (Myc-DDK-tagged)-Human patched 2 (PTCH2), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PTCH2 (Myc-DDK-tagged)-Human patched 2 (PTCH2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PTCH2 (mGFP-tagged)-Human patched 2 (PTCH2), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PTCH2 (mGFP-tagged)-Human patched 2 (PTCH2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PTCH2 (GFP-tagged) - Human patched 2 (PTCH2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PTCH2 (GFP-tagged) - Human patched 2 (PTCH2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PTCH2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of patched homolog 2 (Drosophila) (PTCH2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Patched 2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | residues 226-235 [GPFASLEGFR] of the human PTCH2 protein |
Rabbit Polyclonal Anti-PTCH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTCH2 antibody: synthetic peptide directed towards the N terminal of human PTCH2. Synthetic peptide located within the following region: LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV |
Carrier-free (BSA/glycerol-free) PTCH2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTCH2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
PTCH2 (untagged)-Human patched 2 (PTCH2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PTCH2 (untagged)-Human patched homolog 2 (Drosophila) (PTCH2) transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PTCH2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTCH2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
PTCH2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | HRP |
PTCH2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
PTCH2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTCH2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
PTCH2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | HRP |
PTCH2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Transient overexpression of PTCH2 (NM_003738) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PTCH2 (NM_001166292) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PTCH2 (NM_003738) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PTCH2 (NM_003738) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PTCH2 (NM_001166292) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PTCH2
Pathways
- Basal cell carcinoma