Products

Proteins (20)
Antibodies (16)
cDNA Clones (8)
Jump to Filters
View as table Download
Sonic Hedgehog (SHH) (NM_000193) Human Tagged ORF Clone
RG222175

USD 470.00

In Stock

SHH (GFP-tagged) - Human sonic hedgehog (SHH)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Sonic Hedgehog (SHH) (NM_000193) Human Untagged Clone
SC300021

USD 770.00

In Stock

SHH (untagged)-Human sonic hedgehog (SHH)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Sonic Hedgehog (SHH) (NM_000193) Human Over-expression Lysate
LY424868

USD 605.00

In Stock

Transient overexpression lysate of sonic hedgehog homolog (Drosophila) (SHH)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Sonic hedgehog (SHH) Human Protein
AR20002PU-N

USD 260.00

2 Weeks

Sonic hedgehog (SHH) human protein, 25 µg

Expression Host E. coli
Sonic hedgehog (SHH) Human Protein
AR20002PU-S

USD 145.00

2 Weeks

Sonic hedgehog (SHH) human protein, 5 µg

Expression Host E. coli
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: 5H4]
TA336923

USD 424.00

5 Days

Mouse Monoclonal Sonic Hedgehog/Shh Antibody (5H4)

Applications ELISA, FC, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA336926

USD 457.00

5 Days

Rabbit Polyclonal Sonic Hedgehog/Shh Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human SHH protein (between residues 1-75) [UniProt Q15465]
Sonic Hedgehog (SHH) (N-term) Rabbit Polyclonal Antibody
AP23351PU-N

USD 405.00

2 Weeks

Sonic Hedgehog (SHH) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence near the N-terminal of human SHH
Sonic Hedgehog (SHH) (NM_000193) Human Over-expression Lysate
LC424868

USD 187.00

In Stock

SHH HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA334657

USD 375.00

5 Days

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Chicken, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT
Sonic hedgehog (SHH) (24-197, His-tag) Human Protein
AR09512PU-L

USD 745.00

2 Weeks

Sonic hedgehog (SHH) (24-197, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Sonic hedgehog (SHH) (24-197, His-tag) Human Protein
AR09512PU-N

USD 300.00

2 Weeks

Sonic hedgehog (SHH) (24-197, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Sonic hedgehog (SHH) (24-197, ) Human Protein
AR51857PU-N

USD 845.00

2 Weeks

Sonic hedgehog (SHH) (24-197, ) human recombinant protein, 0.25 mg

Expression Host E. coli
Sonic hedgehog (SHH) (24-197, ) Human Protein
AR51857PU-S

USD 330.00

2 Weeks

Sonic hedgehog (SHH) (24-197, ) human recombinant protein, 50 µg

Expression Host E. coli
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: OTI3A2]
CF500040

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SHH mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: OTI10H6]
CF500041

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SHH mouse monoclonal antibody, clone OTI10H6 (formerly 10H6)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Sonic Hedgehog (SHH) (NM_000193) Human Mass Spec Standard
PH322175

USD 2,055.00

3 Weeks

SHH MS Standard C13 and N15-labeled recombinant protein (NP_000184)

Tag C-Myc/DDK
Expression Host HEK293
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA323715

USD 345.00

In Stock

Anti-SHH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA323716

USD 345.00

In Stock

Anti-SHH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: OTI3A2]
TA500040

USD 379.00

In Stock

Anti-SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: OTI3A2]
TA500040S

USD 159.00

2 Days

Anti-SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: OTI10H6]
TA500041

USD 379.00

In Stock

SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI10H6 (formerly 10H6)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: OTI10H6]
TA500041S

USD 159.00

2 Days

SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI10H6 (formerly 10H6)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Sonic Hedgehog (SHH) ICC Control Block
TB422175

USD 1,080.00

4 Weeks

Transient overexpression of SHH (NM_000193) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Sonic Hedgehog (SHH) (NM_000193) Human Recombinant Protein
TP720599

USD 330.00

3 Weeks

Purified recombinant protein of Human sonic hedgehog (SHH)

Tag tag free
Expression Host E. coli
Sonic Hedgehog (SHH) (NM_000193) Human Recombinant Protein
TP720599L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human sonic hedgehog (SHH)

Tag tag free
Expression Host E. coli
Sonic Hedgehog (SHH) (NM_000193) Human Recombinant Protein
TP720599M

USD 760.00

3 Weeks

Purified recombinant protein of Human sonic hedgehog (SHH)

Tag tag free
Expression Host E. coli
Sonic Hedgehog (SHH) (NM_000193) Human Recombinant Protein
TP720599XL

USD 2,800.00

3 Weeks

Purified recombinant protein of Human sonic hedgehog (SHH)

Tag tag free
Expression Host E. coli
Sonic Hedgehog (SHH) (NM_000193) Human Recombinant Protein
TP720610

USD 330.00

3 Weeks

Purified recombinant protein of Human sonic hedgehog (SHH)

Tag tag free
Expression Host E. coli
Sonic Hedgehog (SHH) (NM_000193) Human Recombinant Protein
TP720610L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human sonic hedgehog (SHH)

Tag tag free
Expression Host E. coli
Sonic Hedgehog (SHH) (NM_000193) Human Recombinant Protein
TP720610M

USD 760.00

3 Weeks

Purified recombinant protein of Human sonic hedgehog (SHH)

Tag tag free
Expression Host E. coli
Sonic Hedgehog (SHH) (NM_000193) Human Recombinant Protein
TP720610XL

USD 2,800.00

3 Weeks

Purified recombinant protein of Human sonic hedgehog (SHH)

Tag tag free
Expression Host E. coli
Sonic Hedgehog (SHH) Cytosection
TS422175

USD 225.00

4 Weeks

Transient overexpression of SHH (NM_000193) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Sonic Hedgehog (SHH) Cytosection
TS422175P5

USD 889.00

4 Weeks

Transient overexpression of SHH (NM_000193) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack